Hck Antibody (2A6) - Azide and BSA Free

Proximity Ligation Assay: Hck Antibody (2A6) [H00003055-M02] - Analysis of protein-protein interactions between FLT1 and HCK. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-HCK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Sandwich ELISA: Hck Antibody (2A6) [H00003055-M02] - Detection limit for recombinant GST tagged HCK is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func
• Clone: 2A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Hck Antibody (2A6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HCK (AAH14435, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK
• Localization: Isoform p60-HCK and isoform p59-HCK are associated with membranes. Isoform p60-HCK is also cytoplasmic.
• Specificity: HCK - hemopoietic cell kinase
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HCK
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hck Antibody (2A6) - Azide and BSA Free

• Bmk
• EC 2.7.10
• EC 2.7.10.2
• Hck
• Hctk
• hemopoietic cell kinaseJTK9
• JTK9
• p59-HCK/p60-HCK
• tyrosine-protein kinase HCK

Background

The protein encoded by this gene is a protein-tyrosine kinase that is predominantly expressed in hemopoietic cell types. The encoded protein may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Alternate translation initiation site usage, including a non-AUG (CUG) codon, results in the production of two different isoforms, that have different subcellular localization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hck Antibody (H00003055-M02)(1)

Publication using H00003055-M02

• Liu CH, Chen TC, Chau GY et al. An analysis of protein-protein interactions in cross-talk pathways reveals CRKL as a novel prognostic marker in hepatocellular carcinoma. Mol Cell Proteomics 2013-02-08 [PMID: 23397142]

Bioinformatics

• Gene Symbol: HCK
• Entrez:
  • 3055(Human)
• OMIM:
  • 142370(Human)
• Uniprot:
  • AAH14435(Human)