HCC1 Antibody - BSA Free

Immunohistochemistry: HCC1 Antibody [NBP3-35596] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using HCC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: HCC1 Antibody [NBP3-35596] - Immunofluorescence analysis of U-2 OS cells using HCC1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: HCC1 Antibody [NBP3-35596] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using HCC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: HCC1 Antibody [NBP3-35596] - Immunohistochemistry analysis of paraffin-embedded Rat liver using HCC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: HCC1 Antibody [NBP3-35596] - Western blot analysis of various lysates using HCC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HCC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HCC1 Antibody - BSA Free (NBP3-35596) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-508 of human HCC1 (NP_001229528.1).
  
  Sequence:
  ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM39
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for HCC1 Antibody - BSA Free

• CAPER alpha
• CAPER
• CAPERalpha
• CC1.3
• coactivator of activating protein-1 and estrogen receptors
• DKFZp781C0423
• FLJ44170
• fSAP59
• functional spliceosome-associated protein 59
• HCC1
• HCC1CAPERalpha
• Hepatocellular carcinoma protein 1
• RBM39
• RNA binding motif protein 39
• RNA-binding motif protein 39
• RNA-binding protein 39
• RNA-binding region-containing protein 2
• RNPC2
• RRM) containing 2
• splicing factor CC1.3
• Splicing factor HCC1

Background

HCC1 is encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM39