HBS1L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HBS1L Antibody [NBP1-85123] - Staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol. Antibody staining is shown in green.

Western Blot: HBS1L Antibody [NBP1-85123] - Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, ICC/IF, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HBS1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HBS1L Antibody - BSA Free (NBP1-85123) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-HBS1L Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HBS1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HBS1L Protein (NBP1-85123PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HBS1L Antibody - BSA Free

• DKFZp434g247
• ERF3-similar protein
• ERFSDKFZp686L13262
• HBS1 (S. cerevisiae)-like
• HBS1KIAA1038EF-1a
• HBS1-like (S. cerevisiae)
• HBS1-like protein
• Hsp70 subfamily B suppressor 1-like protein
• HSPC276

Background

HBS1L encodes a member of the GTP-binding elongation factor family. It is expressed in multiple tissues with the highest expression in heart and skeletal muscle. The intergenic region of this gene and the MYB gene has been identified to be a quantitative trait locus (QTL) controlling fetal hemoglobin level, and this region influnces erythrocyte, platelet, and monocyte counts as well as erythrocyte volume and hemoglobin content. DNA polymorphisms at this region associate with fetal hemoglobin levels and pain crises in sickle cell disease. A single nucleotide polymorphism in exon 1 of this gene is significantly associated with severity in beta-thalassemia/Hemoglobin E. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HBS1L Antibody (NBP1-85123)(2)

Publications using NBP1-85123

• Chumchuen S, Sripichai O, Jearawiriyapaisarn N et al. Induction of fetal hemoglobin: Lentiviral shRNA knockdown of HBS1L in ?0-thalassemia/HbE erythroid cells PloS one 2023-03-08 [PMID: 36888630] (Western Blot, Human)
• Ahmad Y, Boisvert FM, Lundberg E et al. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Mol Cell Proteomics 2012-03-01 [PMID: 22002106]

Bioinformatics

• Gene Symbol: HBS1L