HAPLN2 Recombinant Protein Antigen

Images

 
There are currently no images for HAPLN2 Protein (NBP1-91977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HAPLN2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAPLN2.

Source: E. coli

Amino Acid Sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HAPLN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91977.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HAPLN2 Recombinant Protein Antigen

  • Brain link protein 1
  • brain link protein-1
  • BRAL1
  • HAPLN2
  • hyaluronan and proteoglycan link protein 2

Background

The 340 amino acid long, 37 kDA hyaluronan and proteoglycan link protein 2 encoded by the HAPLN2 gene monitors binding of versication V2 to hyaluronic acid. This protein may be a participant in the formation of the hyaluronan-associated matrix in the central nervous system (CNS). This matrix encourages neuronal confuction and structural stabilization. HAPLN2 participates in PTEN pathway, MAPK signaling, UPA-UPAR pathway, and transendothelial migration of leukocytes. It has been researched regarding its role in rabies, schizophrenia, neuronitis, and malignant glioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
NBP1-85432
Species: Hu, Mu
Applications: IHC,  IHC-P, mIF
AF4085
Species: Hu
Applications: IHC, IP, WB
AF5800
Species: Mu, Rt
Applications: IHC, WB
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NBP3-17045
Species: Hu
Applications: IHC,  IHC-P
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-83945
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
6140-ST
Species: Hu
Applications: EnzAct
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7548
Species: Hu
Applications: IHC
MAB2688
Species: Hu
Applications: WB
NBP1-68910
Species: Mu
Applications: WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB

Publications for HAPLN2 Protein (NBP1-91977PEP) (0)

There are no publications for HAPLN2 Protein (NBP1-91977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAPLN2 Protein (NBP1-91977PEP) (0)

There are no reviews for HAPLN2 Protein (NBP1-91977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HAPLN2 Protein (NBP1-91977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HAPLN2 Products

Research Areas for HAPLN2 Protein (NBP1-91977PEP)

Find related products by research area.

Blogs on HAPLN2

There are no specific blogs for HAPLN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HAPLN2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HAPLN2