HACE1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACE1 (NP_065822). Peptide sequence RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HACE1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
76 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HACE1 Antibody - BSA Free
Background
The HACE1 gene codes for a E3 ubiquitin-protein ligase HACE1 that is a participant in Golgi membrane fusion as well as in regulation of small GTPases to mediate ubiquitination and degradation of active RAC1, working in defense against pathogens. This protein may also play a role as a transcription regulator through its interaction with RARB. HACE1 exists in four isoforms: isoform 1 is 909 amino acids long, 102 kDA; isoform 2 is 318 amino acids long, 35 kDA; isoform 3 is 562 amino acids long, 63 kDA; isoform 4 is 694 amino acids long, nearly 78 kDA. HACE1 has been researched in regards to celiac disease, malaria, colorectal cancer, wilms tumors, and carcinoma. It is involved in the SMAD signaling network as well as ubiquitin-proteasome dependent proteolysis and has been known to interact with genes RARA, RAB4A, RAC1, PLXNA2, and IRF7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Publications for HACE1 Antibody (NBP3-10567) (0)
There are no publications for HACE1 Antibody (NBP3-10567).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HACE1 Antibody (NBP3-10567) (0)
There are no reviews for HACE1 Antibody (NBP3-10567).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HACE1 Antibody (NBP3-10567) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HACE1 Products
Research Areas for HACE1 Antibody (NBP3-10567)
Find related products by research area.
|
Blogs on HACE1