HABP1/C1QBP/GC1q R Recombinant Protein Antigen

Images

 
There are currently no images for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HABP1/C1QBP/GC1q R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C1QBP.

Source: E. coli

Amino Acid Sequence: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1QBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89790.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HABP1/C1QBP/GC1q R Recombinant Protein Antigen

  • C1q globular domain-binding protein
  • C1QBP
  • complement component 1 Q subcomponent-binding protein, mitochondrial
  • complement component 1, q subcomponent binding protein
  • gC1qBP
  • GC1q-R protein
  • gC1qR
  • gC1Q-R
  • Glycoprotein gC1qBP
  • HABP1
  • HABP1p33
  • Hyaluronan-binding protein 1
  • Mitochondrial matrix protein p32
  • p32
  • SF2p32
  • splicing factor SF2-associated protein

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
AF1696
Species: Mu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1396
Species: Hu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85525
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Single-Cell Western, WB
NBP1-87905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP) (0)

There are no publications for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP) (0)

There are no reviews for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HABP1/C1QBP/GC1q R Products

Research Areas for HABP1/C1QBP/GC1q R Protein (NBP1-89790PEP)

Find related products by research area.

Blogs on HABP1/C1QBP/GC1q R

There are no specific blogs for HABP1/C1QBP/GC1q R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HABP1/C1QBP/GC1q R Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QBP