HABP1/C1QBP/GC1q R Antibody

Images

 
Western Blot: HABP1/C1QBP/GC1q R Antibody [H00000708-B01P] - Analysis of C1QBP expression in human liver.
Immunocytochemistry/ Immunofluorescence: HABP1/C1QBP/GC1q R Antibody [H00000708-B01P] - Analysis of purified antibody to C1QBP on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: HABP1/C1QBP/GC1q R Antibody [H00000708-B01P] - Analysis of C1QBP expression in HL-60.
Western Blot: HABP1/C1QBP/GC1q R Antibody [H00000708-B01P] - Analysis of C1QBP expression in transfected 293T cell line by C1QBP polyclonal antibody. Lane 1: C1QBP transfected lysate(31.02 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HABP1/C1QBP/GC1q R Antibody Summary

Immunogen
C1QBP (NP_001203.1, 1 a.a. - 282 a.a.) full-length human protein. MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Specificity
Reacts with complement component 1, q subcomponent binding protein.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
C1QBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against cell, tissue and transfected lysate in WB, IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HABP1/C1QBP/GC1q R Antibody

  • C1q globular domain-binding protein
  • C1QBP
  • complement component 1 Q subcomponent-binding protein, mitochondrial
  • complement component 1, q subcomponent binding protein
  • gC1qBP
  • GC1q-R protein
  • gC1qR
  • gC1Q-R
  • Glycoprotein gC1qBP
  • HABP1
  • HABP1p33
  • Hyaluronan-binding protein 1
  • Mitochondrial matrix protein p32
  • p32
  • SF2p32
  • splicing factor SF2-associated protein

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000712-P01
Species: Hu
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-37308
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1396
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000708-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P) (0)

There are no publications for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P) (0)

There are no reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HABP1/C1QBP/GC1q R Products

Bioinformatics Tool for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P)

Discover related pathways, diseases and genes to HABP1/C1QBP/GC1q R Antibody (H00000708-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P)

Discover more about diseases related to HABP1/C1QBP/GC1q R Antibody (H00000708-B01P).
 

Pathways for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P)

View related products by pathway.

PTMs for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P)

Learn more about PTMs related to HABP1/C1QBP/GC1q R Antibody (H00000708-B01P).
 

Research Areas for HABP1/C1QBP/GC1q R Antibody (H00000708-B01P)

Find related products by research area.

Blogs on HABP1/C1QBP/GC1q R

There are no specific blogs for HABP1/C1QBP/GC1q R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HABP1/C1QBP/GC1q R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QBP
Entrez
Uniprot