Home » HABP1/C1QBP/GC1q R » C1QBP Antibodies » HABP1/C1QBP/GC1q R Antibody (1F3)

HABP1/C1QBP/GC1q R Antibody (1F3)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: HABP1/C1QBP/GC1q R Antibody (1F3) [H00000708-M01] - Detection limit for recombinant GST tagged C1QBP is approximately 0.03ng/ml as a capture antibody.
Sandwich ELISA: HABP1/C1QBP/GC1q R Antibody (1F3) [H00000708-M01] - Detection limit for recombinant GST tagged C1QBP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HABP1/C1QBP/GC1q R Antibody (1F3) Summary

Immunogen
C1QBP (NP_001203.1, 173 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Specificity
C1QBP - complement component 1, q subcomponent binding protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
C1QBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HABP1/C1QBP/GC1q R Antibody (1F3)

  • C1q globular domain-binding protein
  • C1QBP
  • complement component 1 Q subcomponent-binding protein, mitochondrial
  • complement component 1, q subcomponent binding protein
  • gC1qBP
  • GC1q-R protein
  • gC1qR
  • gC1Q-R
  • Glycoprotein gC1qBP
  • HABP1
  • HABP1p33
  • Hyaluronan-binding protein 1
  • Mitochondrial matrix protein p32
  • p32
  • SF2p32
  • splicing factor SF2-associated protein

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD44 Antibody
(8E2F3)
NBP1-47386
Immunocytochemistry/Immunofluorescence: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of paraffin-embedded human lung cancer tissues using anti-CD44 mAb (green), showing membrane localization. DRAQ5 fluorescent DNA dye (blue).
Immunohistochemistry-Paraffin: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of FFPE human breast carcinoma tissues using CD44 antibody (8E2F3). The signal was developed using DAB based detection and the sections were processed for counterstaining with hematoxylin. The antibody generated mainly a membrane staining representative of CD44 protein.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(13 Publications)
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
C1q Antibody
NBP1-87492
Western Blot: C1q Antibody [NBP1-87492] - Analysis in control (vector only transfected HEK293T lysate) and C1QA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western Blot: C1q Antibody [NBP1-87492] - Analysis in human spleen tissue.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
ING1 Antibody
AF5758
Western blot shows lysates of A549 human lung carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ING1 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
ING1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using 10 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
ING1 was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using 5 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, IHC, ICC
C1qR1/CD93 Antibody
NBP1-88317
Western Blot: C1qR1/CD93 Antibody [NBP1-88317] - Analysis in control (vector only transfected HEK293T lysate) and CD93 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: C1qR1/CD93 Antibody [NBP1-88317] - Staining of human cell line HUVEC TERT2 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: C1qR1/CD93 Antibody [NBP1-88317] - Analysis in human lung and skeletal muscle tissues. Corresponding CD93 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Kininogen Antibody
NBP1-89993
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.
Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CDK5 Activator 1
Antibody
AF7250
CDK5 Activator 1 was detected in immersion fixed paraffin-embedded sections of human brain (cerebellum) using Sheep Anti-Human CDK5 Activator 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7250) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent‑Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei in neuronal cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC
SF2 Antibody
NBP2-20324
Western Blot: SF2 Antibody [NBP2-20324] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SF2 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SF2 Antibody [NBP2-20324] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using SF2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: SF2 Antibody [NBP2-20324] - Paraffin-embedded mouse duodenum. SF2 antibody dilution: 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cyclin H Antibody
(SN20-48)
NBP2-67719
Western Blot: Cyclin H Antibody (SN20-48) [NBP2-67719] - Analysis of Cyclin H on K562 cells lysates using anti-Cyclin H antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Cyclin H Antibody (SN20-48) [NBP2-67719] - Staining Cyclin H in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cyclin H Antibody (SN20-48) [NBP2-67719] - Analysis of paraffin-embedded mouse testis tissue using anti-Cyclin H antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Calreticulin
Antibody
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was conjugated with Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
(25 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
Annexin A2
Antibody [Unconjugate
AF3928
Western blot shows lysates of A431 human epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, and L6 rat myoblast cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Annexin A2 at approximately 39 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Annexin A2 was detected in immersion fixed paraffin-embedded sections of normal human liver using Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membranes of hepatocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Annexin A2 at approximately 45 kDa (as indicated) using 50 µg/mL of Goat Anti-Human/Mouse/Rat Annexin A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3928) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12‑230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Factor XII Antibody
NBP1-94203
Western Blot: Factor XII/F12 Antibody [NBP1-94203] - WB analysis of F12 in 1. NIH 3T3 cell lysate and 2. Cos7 cell lysate.
Immunocytochemistry/Immunofluorescence: Factor XII Antibody [NBP1-94203] - F12 antibody was tested in NIH/3T3 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Factor XII Antibody [NBP1-94203] - IHC analysis of F12 in human renal cancer using DAB with hematoxylin counterstain.
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NT5C3 Antibody
NBP1-85525
Western Blot: NT5C3 Antibody [NBP1-85525] - Analysis in control (vector only transfected HEK293T lysate) and NT5C3A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: NT5C3 Antibody [NBP1-85525] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Cytokeratin 1
Antibody (LHK1)
NB100-2756
Immunohistochemistry-Paraffin: Cytokeratin 1 Antibody (LHK1) [NB100-2756] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human breast cancer using 5ug/ml conc. of Cytokeratin 1 antibody (clone LHK1) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). A membrane-cytoplasmic staining of Cytokeratin 1 was observed in the cancer cells with signal localized more to the cell membranes. Tumor cores showed a decreased staining and tumor stroma was mostly negative for Cytokeratin 1.
Immunohistochemistry-Paraffin: Cytokeratin 1 Antibody (LHK1) [NB100-2756] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human breast cancer using 5ug/ml conc. of Cytokeratin 1 antibody (clone LHK1) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). A membrane-cytoplasmic staining of Cytokeratin 1 was observed in the cancer cells with signal localized more to the cell membranes. Tumor stroma was mostly negative for Cytokeratin 1. Staining was performed by Histowiz.
Western Blot: Cytokeratin 1 Antibody (LHK1) [NB100-2756] - Analysis of Cytokeratin 1 in Caco-2.
(13 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
FLJ11506 Antibody
NBP1-87905
Western Blot: FLJ11506 Antibody [NBP1-87905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: FLJ11506 Antibody [NBP1-87905] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FLJ11506 Antibody [NBP1-87905] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no publications for HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional HABP1/C1QBP/GC1q R Products

Bioinformatics Tool for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Discover related pathways, diseases and genes to HABP1/C1QBP/GC1q R Antibody (H00000708-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Discover more about diseases related to HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
 

Pathways for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

View related products by pathway.

PTMs for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Learn more about PTMs related to HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
 

Research Areas for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Find related products by research area.

Blogs on HABP1/C1QBP/GC1q R

There are no specific blogs for HABP1/C1QBP/GC1q R, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HABP1/C1QBP/GC1q R Antibody (1F3) and receive a gift card or discount.


Bioinformatics

Gene Symbol C1QBP
Entrez
OMIM
Uniprot