Home » HABP1/C1QBP/GC1q R » C1QBP Antibodies » HABP1/C1QBP/GC1q R Antibody (1F3)

HABP1/C1QBP/GC1q R Antibody (1F3)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: HABP1/C1QBP/GC1q R Antibody (1F3) [H00000708-M01] - Detection limit for recombinant GST tagged C1QBP is approximately 0.03ng/ml as a capture antibody.
Sandwich ELISA: HABP1/C1QBP/GC1q R Antibody (1F3) [H00000708-M01] - Detection limit for recombinant GST tagged C1QBP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HABP1/C1QBP/GC1q R Antibody (1F3) Summary

Immunogen
C1QBP (NP_001203.1, 173 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Specificity
C1QBP - complement component 1, q subcomponent binding protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
C1QBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HABP1/C1QBP/GC1q R Antibody (1F3)

  • C1q globular domain-binding protein
  • C1QBP
  • complement component 1 Q subcomponent-binding protein, mitochondrial
  • complement component 1, q subcomponent binding protein
  • gC1qBP
  • GC1q-R protein
  • gC1qR
  • gC1Q-R
  • Glycoprotein gC1qBP
  • HABP1
  • HABP1p33
  • Hyaluronan-binding protein 1
  • Mitochondrial matrix protein p32
  • p32
  • SF2p32
  • splicing factor SF2-associated protein

Background

The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD44 Antibody
(8E2F3) - BSA Free
NBP1-47386
Flow (Intracellular): CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(17 Publications)
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
C1q Antibody
NBP1-87492
Western Blot: C1q Antibody [NBP1-87492] - Analysis in human spleen tissue.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human duodenum shows strong positivity in plasma.
Immunohistochemistry-Paraffin: C1q Antibody [NBP1-87492] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
ING1 Antibody
AF5758
Western blot shows lysates of A549 human lung carcinoma cell line . PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ING1 at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
ING1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using 10 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
ING1 was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using 5 µg/mL Goat Anti-Human ING1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5758) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, IHC, WB
C1qR1/CD93
Antibody [Unconjugate
AF2379
C1qR1/CD93 was detected in immersion fixed U937 human histiocytic lymphoma cell line using Goat Anti-Human C1qR1/CD93 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2379) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Staining was performed using our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining in human kidney and skeletal muscle tissues.. Corresponding Kininogen RNA-seq data are presented for the same tissues.
Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/Immunofluorescence: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunofluorescent analysis. Sample: DIV10 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Red: alpha Tubulin, stained by alpha Tubulin antibody [GT114] (NBP2-43837) diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded mouse brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: CDK5 Activator 1 Antibody [NBP3-13279] - CDK5 Activator 1 antibody detects CDK5 Activator 1 protein by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. CDK5 Activator 1 stained by CDK5 Activator 1 antibody (NBP3-13279) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SF2 Antibody
NBP2-20324
Western Blot: SF2 Antibody [NBP2-20324] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with SF2 antibody diluted at 1:5000.
Western Blot: SF2 Antibody [NBP2-20324] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: SF2 Antibody [NBP2-20324] - Antibody detects SFRS1 protein at nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. Antibody dilution: 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Cyclin H Antibody
(1B8)
H00000902-M01
Western Blot: Cyclin H Antibody (1B8) [H00000902-M01] - Analysis of CCNH expression in transfected 293T cell line by CCNH monoclonal antibody (M01), clone 1B8.Lane 1: CCNH transfected lysate(37.6 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Cyclin H Antibody (1B8) [H00000902-M01] - Analysis of monoclonal antibody to CCNH on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Cyclin H Antibody (1B8) [H00000902-M01] - Analysis of monoclonal antibody to CCNH on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human tonsil shows strong nuclear positivity in non - germinal center cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - The Calreticulin antibody NB600-101 was tested in HeLa cells at a 1:250 dilution against DyLight 488 (Green). Alpha-tubulin and nuclei were counterstained against DyLight 550 (Red) and DAPI (Blue), respectively.
(27 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody (1G7) [H00000302-M02] - Localization of annexin A2 at the focal adhesions: KS1767 cells co-stained for paxillin (FITC-conjugated secondary antibody, green) and annexin A2 (Alexa 647-conjugated secondary antibody, red). An enlarged inset (white dotted line) is included for prompt visualization. Nuclei are visualized with DAPI (blue); scale bar, 10um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-017-03470-w), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Annexin A2 Antibody (1G7) [H00000302-M02] - Co-localization analysis: KS1767 cells grown overnight onto circular coverslips were incubated for 2h at 37degrees C with biotinylated LGRFYAASG-pen, or unconjugated LGRFYAASG (10uM). Untreated cells were used as controls. IF staining of biotinylated peptides (avidin-FITC, green) and annexin A2 (Cy3-conjugated secondary antibody, red) was analyzed with Fiji ImageJ. Co-localized pixels are visualized in white (arrows), and Manders' overlap coefficients are reported in the graph (**P<0.01; ***P<0.001 versus LGRFYAASG-pen). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-017-03470-w), licensed under a CC-BY licence.
Western Blot: Annexin A2 Antibody (1G7) [H00000302-M02] - Analysis of ANXA2 expression in transfected 293T cell line by ANXA2 monoclonal antibody (M02), clone 1G7.Lane 1: ANXA2 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Factor XII Antibody
NBP1-94203
Western Blot: Factor XII/F12 Antibody [NBP1-94203] - WB analysis of F12 in 1. NIH 3T3 cell lysate and 2. Cos7 cell lysate.
Immunocytochemistry/Immunofluorescence: Factor XII Antibody [NBP1-94203] - F12 antibody was tested in NIH/3T3 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Factor XII Antibody [NBP1-94203] - IHC analysis of F12 in human renal cancer using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NT5C3 Antibody
NBP1-85525
Western Blot: NT5C3 Antibody [NBP1-85525] - Analysis in control (vector only transfected HEK293T lysate) and NT5C3A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: NT5C3 Antibody [NBP1-85525] - Staining of human rectum shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Cytokeratin, pan
Antibody (AE-1/AE-3)
NBP2-29429
Dual RNAscope ISH-IHC: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - FFPE tissue sections of human metastatic tonsil were probed for Pan Cytokeratin mRNA (ACD RNAScope probe, catalog # 310221; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processes for IHC using mouse monoclonal antibody (Novus catalog # NBP2-29429) at 0.3 ug/mL for 1 hour at room temperature followed by incubation with the anti-mouse IgG VisUCyte HRP Polymer Antibody (Novus Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
CyTOF-reported: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human fibroblasts. Blue: fibroblasts. Red: fibroblast + cytokeratin transfection. CyTOF image submitted by a verified customer review.
Flow Cytometry: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human Pan-Cytokeratins on HeLa Cells. Black: Cells alone; Green: Isotype Control; Red: PE-labeled Pan-Cytokeratin Monoclonal Antibody (AE-1/AE-3)
(1 Review)
(39 Publications)
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
FLJ11506 Antibody
NBP1-87905
Immunohistochemistry-Paraffin: FLJ11506 Antibody [NBP1-87905] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: FLJ11506 Antibody [NBP1-87905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: FLJ11506 Antibody [NBP1-87905] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol Antibody staining is shown in green.
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no publications for HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no reviews for HABP1/C1QBP/GC1q R Antibody (H00000708-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HABP1/C1QBP/GC1q R Antibody (H00000708-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HABP1/C1QBP/GC1q R Products

Bioinformatics Tool for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Discover related pathways, diseases and genes to HABP1/C1QBP/GC1q R Antibody (H00000708-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Discover more about diseases related to HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
 

Pathways for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

View related products by pathway.

PTMs for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Learn more about PTMs related to HABP1/C1QBP/GC1q R Antibody (H00000708-M01).
 

Research Areas for HABP1/C1QBP/GC1q R Antibody (H00000708-M01)

Find related products by research area.

Blogs on HABP1/C1QBP/GC1q R

There are no specific blogs for HABP1/C1QBP/GC1q R, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HABP1/C1QBP/GC1q R Antibody (1F3) and receive a gift card or discount.


Bioinformatics

Gene Symbol C1QBP
Entrez
OMIM
Uniprot