HA95/AKAP8L Recombinant Protein Antigen

Images

 
There are currently no images for HA95/AKAP8L Protein (NBP2-47441PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HA95/AKAP8L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP8L.

Source: E.coli

Amino Acid Sequence: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP8L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47441.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HA95/AKAP8L Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein 8-like
  • AKAP8-like protein
  • HA95
  • HAP95 DKFZp434L0650
  • helicase A-binding protein 95 kDa
  • Homologous to AKAP95 protein
  • HRIHFB2018
  • NAKAP
  • NAKAP95 A-kinase anchor protein 8-like
  • neighbor of A kinase anchoring protein 95
  • Neighbor of AKAP95
  • Neighbor of A-kinase-anchoring protein 95

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79139
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15319
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52876
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no publications for HA95/AKAP8L Protein (NBP2-47441PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no reviews for HA95/AKAP8L Protein (NBP2-47441PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HA95/AKAP8L Products

Bioinformatics Tool for HA95/AKAP8L Protein (NBP2-47441PEP)

Discover related pathways, diseases and genes to HA95/AKAP8L Protein (NBP2-47441PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HA95/AKAP8L Protein (NBP2-47441PEP)

Discover more about diseases related to HA95/AKAP8L Protein (NBP2-47441PEP).
 

Pathways for HA95/AKAP8L Protein (NBP2-47441PEP)

View related products by pathway.

PTMs for HA95/AKAP8L Protein (NBP2-47441PEP)

Learn more about PTMs related to HA95/AKAP8L Protein (NBP2-47441PEP).
 

Research Areas for HA95/AKAP8L Protein (NBP2-47441PEP)

Find related products by research area.

Blogs on HA95/AKAP8L.

HA95: Regulator of Nuclear Envelope Dynamics
HA95 is a nuclear protein with high homology to the nuclear A-kinase anchoring protein AKAP95, involved in the regulation of nuclear envelope-chromatin interactions. Antibody immunostaining data indicate that HA95 is tightly associated with chromatin...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HA95/AKAP8L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP8L