HA95/AKAP8L Recombinant Protein Antigen

Images

 
There are currently no images for HA95/AKAP8L Protein (NBP2-47441PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HA95/AKAP8L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AKAP8L.

Source: E. coli

Amino Acid Sequence: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKAP8L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47441.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HA95/AKAP8L Recombinant Protein Antigen

  • A kinase (PRKA) anchor protein 8-like
  • AKAP8-like protein
  • HA95
  • HAP95 DKFZp434L0650
  • helicase A-binding protein 95 kDa
  • Homologous to AKAP95 protein
  • HRIHFB2018
  • NAKAP
  • NAKAP95 A-kinase anchor protein 8-like
  • neighbor of A kinase anchoring protein 95
  • Neighbor of AKAP95
  • Neighbor of A-kinase-anchoring protein 95

Background

AKAP8L/HA95 is a PKA anchoring protein that is localized to the nuclear envelope and associates with chromatin upon nuclear envelope breakdown during mitosis. AKAP8L/HA95 has been found to play an important role in the initiation of DNA replication and may function as a scaffold for proteins such as MCM2 and LAP2beta. Additionally, AKAP8L/HA95 has been shown to co-locate with the PKA C subunit in splicing factor compartments and is involved in the regulation of pre-mRNA splicing. Further support for a scaffolding and splicing role in the nucleus comes from the observation that AKAP8L/HA95 colocalizes with HypA, a splicing-like factor, and through this association may function as a docking site for the nuclear accumulation of Huntington protein as seen in Huntington's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90196
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89172
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-38713
Species: Hu
Applications: IHC,  IHC-P
7754-BH/CF
Species: Hu
Applications: BA
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-46179
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47441PEP
Species: Hu
Applications: AC

Publications for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no publications for HA95/AKAP8L Protein (NBP2-47441PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no reviews for HA95/AKAP8L Protein (NBP2-47441PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HA95/AKAP8L Protein (NBP2-47441PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HA95/AKAP8L Products

Research Areas for HA95/AKAP8L Protein (NBP2-47441PEP)

Find related products by research area.

Blogs on HA95/AKAP8L.

HA95: Regulator of Nuclear Envelope Dynamics
HA95 is a nuclear protein with high homology to the nuclear A-kinase anchoring protein AKAP95, involved in the regulation of nuclear envelope-chromatin interactions. Antibody immunostaining data indicate that HA95 is tightly associated with chromatin ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HA95/AKAP8L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP8L