H4 Clustered Histone 1 Antibody [CoraFluor™ 1] Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human H4 Clustered Histone 1 (NP_003529.1).
Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
H4C1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. Do not freeze. |
Buffer |
PBS |
Preservative |
No Preservative |
Purity |
Affinity purified |
Notes
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
Alternate Names for H4 Clustered Histone 1 Antibody [CoraFluor™ 1]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: EnzAct
Species: Ce
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Publications for H4 Clustered Histone 1 Antibody (NBP3-35167CL1) (0)
There are no publications for H4 Clustered Histone 1 Antibody (NBP3-35167CL1).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for H4 Clustered Histone 1 Antibody (NBP3-35167CL1) (0)
There are no reviews for H4 Clustered Histone 1 Antibody (NBP3-35167CL1).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for H4 Clustered Histone 1 Antibody (NBP3-35167CL1) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional H4 Clustered Histone 1 Products
Blogs on H4 Clustered Histone 1