Recombinant Human H1FOO GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human H1FOO GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 207 of Human H1FOO full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
H1FOO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
47.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human H1FOO GST (N-Term) Protein

  • H1 histone family, member O, oocyte-specific
  • H1OO
  • histone H1oo
  • MGC50807
  • Oocyte-specific histone H1
  • Oocyte-specific linker histone H1
  • osH1

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The protein encoded is a member of the histone H1 family. The related mouse gene is expressed only in oocytes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

739-G9/CF
Species: Mu
Applications: BA
5096-BM
Species: Hu
Applications: BA
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-30830
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBL1-17958
Species: Hu
Applications: WB
NBP1-86241
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-75932
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-62315
Species: Hu
Applications: WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NBL1-11554
Species: Hu
Applications: WB
NB500-174
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-80104
Species: Hu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67313
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for H1FOO Recombinant Protein (H00132243-P01) (0)

There are no publications for H1FOO Recombinant Protein (H00132243-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1FOO Recombinant Protein (H00132243-P01) (0)

There are no reviews for H1FOO Recombinant Protein (H00132243-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H1FOO Recombinant Protein (H00132243-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H1FOO Products

Bioinformatics Tool for H1FOO Recombinant Protein (H00132243-P01)

Discover related pathways, diseases and genes to H1FOO Recombinant Protein (H00132243-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H1FOO Recombinant Protein (H00132243-P01)

Discover more about diseases related to H1FOO Recombinant Protein (H00132243-P01).
 

Pathways for H1FOO Recombinant Protein (H00132243-P01)

View related products by pathway.

PTMs for H1FOO Recombinant Protein (H00132243-P01)

Learn more about PTMs related to H1FOO Recombinant Protein (H00132243-P01).
 

Research Areas for H1FOO Recombinant Protein (H00132243-P01)

Find related products by research area.

Blogs on H1FOO

There are no specific blogs for H1FOO, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human H1FOO GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H1FOO