H1FOO Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

H1FOO Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human H1FOO.
  
  

  Source: E. coli

  Amino Acid Sequence: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: H1FOO
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86265.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for H1FOO Recombinant Protein Antigen

• H1 histone family, member O, oocyte-specific
• H1OO
• histone H1oo
• MGC50807
• Oocyte-specific histone H1
• Oocyte-specific linker histone H1
• osH1

Background

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H1FOO gene encodes a H1 Histone Family, member O, oocyte-specific protein. One isoform is 346 amino acids long at 35 kDA while isoform 2 is 207 amino acids long at 21 kDA. The replacement of H1c with H1FOO may be critical to nuclear remodeling as greater mobility of H1FOO increases stability of the embryonic chromatin structure. H1FOO participates in histone modification and cell cycle chromosome condensation in prometaphase. H1FOO has been studied in regards to premature ovarian failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: H1FOO