We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

H1FOO Recombinant Protein Antigen

Images

 
There are currently no images for H1FOO Protein (NBP1-86265PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

H1FOO Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human H1FOO.

Source: E. coli

Amino Acid Sequence: YRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
H1FOO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86265.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for H1FOO Recombinant Protein Antigen

  • H1 histone family, member O, oocyte-specific
  • H1OO
  • histone H1oo
  • MGC50807
  • Oocyte-specific histone H1
  • Oocyte-specific linker histone H1
  • osH1

Background

Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H1FOO gene encodes a H1 Histone Family, member O, oocyte-specific protein. One isoform is 346 amino acids long at 35 kDA while isoform 2 is 207 amino acids long at 21 kDA. The replacement of H1c with H1FOO may be critical to nuclear remodeling as greater mobility of H1FOO increases stability of the embryonic chromatin structure. H1FOO participates in histone modification and cell cycle chromosome condensation in prometaphase. H1FOO has been studied in regards to premature ovarian failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

739-G9
Species: Mu
Applications: BA
5096-BM
Species: Hu
Applications: BA
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-30830
Species: Hu
Applications: IHC,  IHC-P
NBL1-17958
Species: Hu
Applications: WB
NBP1-86241
Species: Hu
Applications:  IHC-P, WB
NBP1-86823
Species: Hu
Applications: IHC,  IHC-P
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB500-174
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-80104
Species: Hu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-52178
Species: Hu
Applications: WB

Publications for H1FOO Protein (NBP1-86265PEP) (0)

There are no publications for H1FOO Protein (NBP1-86265PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1FOO Protein (NBP1-86265PEP) (0)

There are no reviews for H1FOO Protein (NBP1-86265PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for H1FOO Protein (NBP1-86265PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H1FOO Products

Array NBP1-86265PEP

Research Areas for H1FOO Protein (NBP1-86265PEP)

Find related products by research area.

Blogs on H1FOO

There are no specific blogs for H1FOO, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our H1FOO Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol H1FOO