We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GTF2A1L Recombinant Protein Antigen

Images

 
There are currently no images for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GTF2A1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2A1L

Source: E.coli

Amino Acid Sequence: GRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF2A1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24888It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF2A1L Recombinant Protein Antigen

  • 1-like factor
  • general transcription factor IIA, 1-like
  • GTF2A1LF
  • MGC26254
  • TFIIA large subunit isoform ALF
  • TFIIA-alpha and beta-like factor
  • TFIIA-alpha/beta-like factor

Background

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-55408
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP1-86953
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-45867
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP1-87679
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80795
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20253
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
201-LB
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB

Publications for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP) (0)

There are no publications for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP) (0)

There are no reviews for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2A1L Recombinant Protein Antigen (NBP3-24888PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2A1L Products

Blogs on GTF2A1L

There are no specific blogs for GTF2A1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF2A1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2A1L