GTF2A1 Antibody (2H5) - Azide and BSA Free

Sandwich ELISA: GTF2A1 Antibody (2H5) [H00002957-M01] - Detection limit for recombinant GST tagged GTF2A1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2H5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GTF2A1 Antibody (2H5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GTF2A1 (NP_056943, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE
• Localization: Nuclear
• Specificity: GTF2A1 - general transcription factor IIA, 1, 19/37kDa
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GTF2A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF2A1 Antibody (2H5) - Azide and BSA Free

• General transcription factor IIA subunit 1
• general transcription factor IIA, 1, 19/37kDa
• glucose regulated protein, 58kD pseudogene
• MGC129969
• MGC129970
• TF2A1
• TFIIA alpha, p55
• TFIIA
• TFIIA-42
• TFIIAL
• transcription initiation factor IIA subunit 1
• Transcription initiation factor TFIIA 42 kDa subunit

Background

GTF2A1 bind to the TBP-DNA complex and to increase the affinity of TBP for the TATA element. Human GTF2A1 consists of three subunits of 35 kDa (alpha subunit), 19 kDa (beta subunit) and 12 kDa (gamma subunit). The alpha and beta units are derived from the product, p55, of a single gene by an unknown mechanism. However, recombinant p55, in combination with a 12 kDa subunit (gamma subunit), retains native GTF2A1 activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2A1
• Entrez:
  • 2957(Human)
• OMIM:
  • 600520(Human)
• Uniprot:
  • NP_056943(Human)