GSK-3 beta Antibody - BSA Free

Western Blot: GSK-3 beta Antibody [NBP3-02983] - Analysis of extracts of various cell lines, using GSK-3 beta antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Kit.

Western Blot: GSK-3 beta Antibody [NBP3-02983] - Analysis of 200ug extracts of 22Rv1 cells, using GSK-3 beta antibody . Western blot was performed from the immunoprecipitate using this antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GSK-3 beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GSK-3 beta Antibody - BSA Free (NBP3-02983) is a polyclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 320-420 of human GSK-3 beta (NP_001139628.1). LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSK3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:50 - 1:100
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for GSK-3 beta Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.26
• glycogen synthase kinase 3 beta
• glycogen synthase kinase-3 beta
• GSK3 beta
• GSK-3 beta
• GSK3B
• GSK3beta isoform

Background

Glycogen synthase kinase 3beta (GSK-3 beta) is a Serine/Threonine protein kinas involved in the insulin and wingless pathways (1-2). Originally identified as a regulator of glycogen synthase, it has been shown to regulate a diverse array of cellular functions. GSK-3 beta activity is down regulated by phosphorylation on Serine 9 by PKB, or activated by phosphorylation on Tyrosine 216. Once activated, the protein can phosphorylate p53, c-jun, heat shock factor-1 and cyclin D1 (3-4). It is also known to phosphorylate Tau in Allzheimer's disease. Additionally, increased GSK-3 beta protein levels are found in Alzheimer's disease brains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GSK3B