GSK-3 alpha Antibody (4I10Q9) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSK-3 alpha (P49840). MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
GSK3A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunoprecipitation 1:500 - 1:1000
- Knockout Validated
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GSK-3 alpha Antibody (4I10Q9)
Background
Glycogen synthases kinase 3 alpha (GSK3-alpha) is a multifunctional Serine/Threonine protein kinase, one of two isoforms of GSK3 (1). Originally identified as a regulator of glycogen synthase, it has been shown to be involved in the hormonal control of several regulatory factors and transcription factors. GSK3-alpha activity is down regulated by phosphorylation on Serine 21 by PKB, or activated by phosphorylation on Tyrosine 279 (2). Insulin inactivates GSK3-alpha by rapid phosphorylation which leads to activation of Glycogen Synthase in the cells (3). GSK3-alpha activitiy has been linked to a pathogenic mechanism in Alzheimer's disease (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IP, KO
Publications for GSK-3 alpha Antibody (NBP3-15639) (0)
There are no publications for GSK-3 alpha Antibody (NBP3-15639).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GSK-3 alpha Antibody (NBP3-15639) (0)
There are no reviews for GSK-3 alpha Antibody (NBP3-15639).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GSK-3 alpha Antibody (NBP3-15639) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GSK-3 alpha Products
Research Areas for GSK-3 alpha Antibody (NBP3-15639)
Find related products by research area.
|
Blogs on GSK-3 alpha