GSH2 Antibody

Images

 
Western Blot: GSH2 Antibody [H00170825-A01] - Detection against Immunogen (33.81 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSH2 Antibody Summary

Immunogen
GSH2 (NP_573574, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag.MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPP PLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH
Specificity
GSH2 - GS homeobox 2
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GSX2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSH2 Antibody

  • GS homeobox 2
  • GSH2
  • Homeobox protein GSH-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14076
Species: Hu
Applications: IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-29861
Species: Mu
Applications: WB
NBP1-90978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
H00170825-A01
Species: Hu
Applications: WB, ELISA

Publications for GSH2 Antibody (H00170825-A01) (0)

There are no publications for GSH2 Antibody (H00170825-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSH2 Antibody (H00170825-A01) (0)

There are no reviews for GSH2 Antibody (H00170825-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSH2 Antibody (H00170825-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSH2 Products

Bioinformatics Tool for GSH2 Antibody (H00170825-A01)

Discover related pathways, diseases and genes to GSH2 Antibody (H00170825-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSH2 Antibody (H00170825-A01)

Discover more about diseases related to GSH2 Antibody (H00170825-A01).
 

Pathways for GSH2 Antibody (H00170825-A01)

View related products by pathway.

PTMs for GSH2 Antibody (H00170825-A01)

Learn more about PTMs related to GSH2 Antibody (H00170825-A01).

Blogs on GSH2

There are no specific blogs for GSH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSX2
Entrez
Uniprot