GSH2 Antibody

Western Blot: GSH2 Antibody [H00170825-A01] - Detection against Immunogen (33.81 KDa) .

Product Discontinued

GSH2 Antibody Summary

• Immunogen: GSH2 (NP_573574, 1 a.a. - 70 a.a.) partial recombinant protein with GST tag. MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCVCPLCVTSHLH
• Specificity: GSH2 - GS homeobox 2
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GSX2
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSH2 Antibody

• GS homeobox 2
• GSH2
• Homeobox protein GSH-2

Background

The GSH2 (also known as GSX2) gene codes for a 304 amino acid long, 32 kDA GS homeobox 2 protein that is a transcription factor that binds to the DNA sequence 5'-CNAATTAG-3'. The GSH2 gene has been researched for its role in leukemia as well as neuronitis. Interactions between GSH2 and ABL1 and NKX2-1 are known to exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSX2
• Entrez:
  • 170825(Human)
• Uniprot:
  • NP_573574(Human)