GRP75/HSPA9B/Mortalin Recombinant Protein Antigen

Images

 
There are currently no images for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRP75/HSPA9B/Mortalin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPA9.

Source: E. coli

Amino Acid Sequence: GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPA9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89729.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRP75/HSPA9B/Mortalin Recombinant Protein Antigen

  • 75 kDa glucose-regulated protein
  • CSA
  • GRP75
  • GRP-75
  • GRP75mthsp75
  • Heat shock 70 kDa protein 9
  • heat shock 70kD protein 9B
  • heat shock 70kDa protein 9 (mortalin)
  • heat shock 70kDa protein 9B (mortalin-2)
  • HSPA9
  • HSPA9B
  • HSPA9BMGC4500
  • Mortalin
  • mortalin, perinuclear
  • Mortalin-2
  • MOT
  • MOT2
  • mot-2
  • MTHSP75
  • p66-mortalin
  • PBP74
  • PBP74CSA
  • Peptide-binding protein 74
  • stress-70 protein, mitochondrial

Background

The HSP 70 family comprises four highly conserved proteins, HSP 70, HSC 70, GRP 75 and GRP 78, which serve a variety of roles. They act as molecular chaperones facilitating the assembly of multi-protein complexes, participate in the translocation of polypeptides across cell membranes and to the nucleus, and aid in the proper folding of nascent polypeptide chains. HSC 70, GRP 75 and GRP 78 are constitutively expressed in primate cells. HSP 70 expression is strongly induced in response to heat stress. HSP 70 and HSC 70, which are found in both the cytosol and nucleus of mammalian cells, play key roles in the cytosolic endoplasmic reticulum and mitochondrial import machinery. They are involved in chaperoning nascent polypeptide chains and in protecting cells against the accumulation of improperly folded proteins. GRP 75 and GRP 78 are unresponsive to heat stress and are induced by glucose deprivation. GRP 75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP 78 is localized in the endoplasmic reticulum, where it receives imported secretory proteins and is involved in the folding and translocation of nascent peptide chains. Research indicates that members of the HSP 70 family may act as force-generating motors, relying on the hydrolysis of ATP for their activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-16019
Species: Hu
Applications: IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-13878
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
203-IL
Species: Hu
Applications: BA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB414
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP) (0)

There are no publications for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP) (0)

There are no reviews for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRP75/HSPA9B/Mortalin Products

Research Areas for GRP75/HSPA9B/Mortalin Protein (NBP1-89729PEP)

Find related products by research area.

Blogs on GRP75/HSPA9B/Mortalin

There are no specific blogs for GRP75/HSPA9B/Mortalin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRP75/HSPA9B/Mortalin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA9