Growth Hormone 2 Antibody (1E11.)

Images

 
Sandwich ELISA: Growth Hormone 2 Antibody (1E11) [H00002689-M01] - Detection limit for recombinant GST tagged GH2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Growth Hormone 2 Antibody (1E11.) Summary

Immunogen
GH2 (AAH20760.1, 27 a.a. - 217 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Specificity
GH2 - growth hormone 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Growth Hormone 2 Antibody (1E11.)

  • GH2
  • GHL
  • GHV
  • GHVgrowth hormone variant
  • GH-VPlacenta-specific growth hormone
  • Growth Hormone 2
  • growth hormone 2hGH-V
  • placental-specific growth hormone

Background

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-46376
Species: Hu
Applications: WB, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1360
Species: Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-59312
Species: Hu
Applications: WB
NBL1-11664
Species: Hu
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF

Publications for Growth Hormone 2 Antibody (H00002689-M01) (0)

There are no publications for Growth Hormone 2 Antibody (H00002689-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Growth Hormone 2 Antibody (H00002689-M01) (0)

There are no reviews for Growth Hormone 2 Antibody (H00002689-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Growth Hormone 2 Antibody (H00002689-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Growth Hormone 2 Products

Bioinformatics Tool for Growth Hormone 2 Antibody (H00002689-M01)

Discover related pathways, diseases and genes to Growth Hormone 2 Antibody (H00002689-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Growth Hormone 2 Antibody (H00002689-M01)

Discover more about diseases related to Growth Hormone 2 Antibody (H00002689-M01).
 

Pathways for Growth Hormone 2 Antibody (H00002689-M01)

View related products by pathway.

PTMs for Growth Hormone 2 Antibody (H00002689-M01)

Learn more about PTMs related to Growth Hormone 2 Antibody (H00002689-M01).
 

Research Areas for Growth Hormone 2 Antibody (H00002689-M01)

Find related products by research area.

Blogs on Growth Hormone 2

There are no specific blogs for Growth Hormone 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Growth Hormone 2 Antibody (1E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol GH2
Entrez
OMIM
Uniprot