Recombinant Human GRINL1A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GRINL1A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 269-368 of Human GRINL1A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
POLR2M
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRINL1A GST (N-Term) Protein

  • DKFZp586F1918
  • glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A
  • Glutamate receptor-like protein 1A
  • GRINL1A downstream protein Gdown4
  • protein GRINL1A
  • protein GRINL1A, isoforms 4/5

Background

This gene (GRINL1A) is part of a complex transcript unit that includes the gene for GRINL1A combined protein (Gcom1). Transcription of this gene occurs at a downstream promoter, with at least three different alternatively spliced variants, grouped together as Gdown for GRINL1A downstream transcripts. The Gcom1 gene uses an upstream promoter for transcription and also has multiple alternatively spliced variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45634
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-45856
Species: Ca, Hu, Mu
Applications: ICC/IF, IF, IHC, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81759
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-83438
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00055197-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-56292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00081488-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for GRINL1A Partial Recombinant Protein (H00081488-Q01) (0)

There are no publications for GRINL1A Partial Recombinant Protein (H00081488-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRINL1A Partial Recombinant Protein (H00081488-Q01) (0)

There are no reviews for GRINL1A Partial Recombinant Protein (H00081488-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRINL1A Partial Recombinant Protein (H00081488-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRINL1A Products

Bioinformatics Tool for GRINL1A Partial Recombinant Protein (H00081488-Q01)

Discover related pathways, diseases and genes to GRINL1A Partial Recombinant Protein (H00081488-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRINL1A Partial Recombinant Protein (H00081488-Q01)

Discover more about diseases related to GRINL1A Partial Recombinant Protein (H00081488-Q01).
 

Pathways for GRINL1A Partial Recombinant Protein (H00081488-Q01)

View related products by pathway.

PTMs for GRINL1A Partial Recombinant Protein (H00081488-Q01)

Learn more about PTMs related to GRINL1A Partial Recombinant Protein (H00081488-Q01).

Blogs on GRINL1A

There are no specific blogs for GRINL1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRINL1A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2M