GRHL2 Recombinant Protein Antigen

Images

 
There are currently no images for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRHL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRHL2.

Source: E.coli

Amino Acid Sequence: NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRHL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-61634. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRHL2 Recombinant Protein Antigen

  • BOMMGC149294
  • Brother of mammalian grainyhead
  • deafness, autosomal dominant 28
  • DFNA28
  • FLJ13782
  • grainyhead-like 2 (Drosophila)
  • grainyhead-like protein 2 homolog
  • TFCP2L3MGC149295
  • Transcription factor CP2-like 3FLJ11172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-57087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-81322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-41273
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-47214
Species: Hu, Mu, Rt, Ca
Applications: IHC, IHC-P, PEP-ELISA
NBP2-61634PEP
Species: Hu
Applications: AC

Publications for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP) (0)

There are no publications for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP) (0)

There are no reviews for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRHL2 Products

Bioinformatics Tool for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP)

Discover related pathways, diseases and genes to GRHL2 Recombinant Protein Antigen (NBP2-61634PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP)

Discover more about diseases related to GRHL2 Recombinant Protein Antigen (NBP2-61634PEP).
 

Pathways for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP)

View related products by pathway.

PTMs for GRHL2 Recombinant Protein Antigen (NBP2-61634PEP)

Learn more about PTMs related to GRHL2 Recombinant Protein Antigen (NBP2-61634PEP).

Blogs on GRHL2

There are no specific blogs for GRHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GRHL2 Antibody
NBP1-88552

Contact Information

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRHL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL2