GRHL2 Antibody [DyLight 755] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human GRHL2 (NP_079191.2).
Sequence: LSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQY |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GRHL2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for GRHL2 Antibody [DyLight 755]
Background
TFCP2L3 is a member of a family of transcription factor genes whose archetype is TFCP2 (MIM 189889), a mammalian ortholog of the Drosophila gene 'grainyhead' (grh).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA
Publications for GRHL2 Antibody (NBP3-35102IR) (0)
There are no publications for GRHL2 Antibody (NBP3-35102IR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRHL2 Antibody (NBP3-35102IR) (0)
There are no reviews for GRHL2 Antibody (NBP3-35102IR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GRHL2 Antibody (NBP3-35102IR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRHL2 Products
Blogs on GRHL2