GRF2 Antibody (3D10)

Images

 
Western Blot: GRF2 Antibody (3D10) [H00002889-M01] - Analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody (M01), clone 3D10.Lane 1: RAPGEF1 transfected lysate(122.7 KDa).Lane 2: ...read more
Sandwich ELISA: GRF2 Antibody (3D10) [H00002889-M01] - Detection limit for recombinant GST tagged RAPGEF1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GRF2 Antibody (3D10) Summary

Immunogen
RAPGEF1 (AAH41710, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQKNLSW
Specificity
RAPGEF1 - Rap guanine nucleotide exchange factor (GEF) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAPGEF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002889-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRF2 Antibody (3D10)

  • C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
  • CRK SH3-binding GNRP
  • DKFZp781P1719
  • Guanine nucleotide-releasing factor 2
  • Protein C3G
  • Rap guanine nucleotide exchange factor (GEF) 1
  • rap guanine nucleotide exchange factor 1

Background

This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF6260
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67427
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-30945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002889-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for GRF2 Antibody (H00002889-M01)(1)

Reviews for GRF2 Antibody (H00002889-M01) (0)

There are no reviews for GRF2 Antibody (H00002889-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRF2 Antibody (H00002889-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRF2 Products

Bioinformatics Tool for GRF2 Antibody (H00002889-M01)

Discover related pathways, diseases and genes to GRF2 Antibody (H00002889-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRF2 Antibody (H00002889-M01)

Discover more about diseases related to GRF2 Antibody (H00002889-M01).
 

Pathways for GRF2 Antibody (H00002889-M01)

View related products by pathway.

PTMs for GRF2 Antibody (H00002889-M01)

Learn more about PTMs related to GRF2 Antibody (H00002889-M01).
 

Research Areas for GRF2 Antibody (H00002889-M01)

Find related products by research area.

Blogs on GRF2

There are no specific blogs for GRF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRF2 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF1
Entrez
OMIM
Uniprot