Recombinant Human GRB10 Protein

Images

 
SDS-Page: GRB10 Partial Recombinant Protein [H00002887-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GRB10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human GRB10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRB10
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRB10 Protein

  • GRB10 adapter protein
  • GRB10 adaptor protein
  • Grb-10
  • GRBIR
  • GRB-IR
  • growth factor receptor-bound protein 10
  • Insulin receptor-binding protein Grb-IR
  • IRBP
  • KIAA0207
  • maternally expressed gene 1
  • MEG1
  • RSS

Background

GRB10 - growth factor receptor-bound protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38230
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for GRB10 Partial Recombinant Protein (H00002887-Q01) (0)

There are no publications for GRB10 Partial Recombinant Protein (H00002887-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB10 Partial Recombinant Protein (H00002887-Q01) (0)

There are no reviews for GRB10 Partial Recombinant Protein (H00002887-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRB10 Partial Recombinant Protein (H00002887-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRB10 Products

Bioinformatics Tool for GRB10 Partial Recombinant Protein (H00002887-Q01)

Discover related pathways, diseases and genes to GRB10 Partial Recombinant Protein (H00002887-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRB10 Partial Recombinant Protein (H00002887-Q01)

Discover more about diseases related to GRB10 Partial Recombinant Protein (H00002887-Q01).
 

Pathways for GRB10 Partial Recombinant Protein (H00002887-Q01)

View related products by pathway.

PTMs for GRB10 Partial Recombinant Protein (H00002887-Q01)

Learn more about PTMs related to GRB10 Partial Recombinant Protein (H00002887-Q01).
 

Research Areas for GRB10 Partial Recombinant Protein (H00002887-Q01)

Find related products by research area.

Blogs on GRB10

There are no specific blogs for GRB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GRB10 Antibody
NBP2-41159

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GRB10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB10