GRB10 Antibody (1A7) Summary
Immunogen |
GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS |
Specificity |
GRB10 - growth factor receptor-bound protein 10 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GRB10 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GRB10 Antibody (1A7)
Background
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ChIP, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Publications for GRB10 Antibody (H00002887-M01) (0)
There are no publications for GRB10 Antibody (H00002887-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GRB10 Antibody (H00002887-M01) (0)
There are no reviews for GRB10 Antibody (H00002887-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GRB10 Antibody (H00002887-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GRB10 Products
Bioinformatics Tool for GRB10 Antibody (H00002887-M01)
Discover related pathways, diseases and genes to GRB10 Antibody (H00002887-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GRB10 Antibody (H00002887-M01)
Discover more about diseases related to GRB10 Antibody (H00002887-M01).
| | Pathways for GRB10 Antibody (H00002887-M01)
View related products by pathway.
|
PTMs for GRB10 Antibody (H00002887-M01)
Learn more about PTMs related to GRB10 Antibody (H00002887-M01).
| | Research Areas for GRB10 Antibody (H00002887-M01)
Find related products by research area.
|
Blogs on GRB10