GRB10 Antibody (1A7) - Azide and BSA Free

Western Blot: GRB10 Antibody (1A7) [H00002887-M01] - GRB10 monoclonal antibody (M01), clone 1A7. Analysis of GRB10 expression in IMR-32.

Sandwich ELISA: GRB10 Antibody (1A7) [H00002887-M01] - Detection limit for recombinant GST tagged GRB10 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GRB10 Antibody (1A7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
• Specificity: GRB10 - growth factor receptor-bound protein 10
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GRB10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRB10 Antibody (1A7) - Azide and BSA Free

• GRB10 adapter protein
• GRB10 adaptor protein
• Grb-10
• GRBIR
• GRB-IR
• growth factor receptor-bound protein 10
• Insulin receptor-binding protein Grb-IR
• IRBP
• KIAA0207
• maternally expressed gene 1
• MEG1
• RSS

Background

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRB10
• Entrez:
  • 2887(Human)
• OMIM:
  • 601523(Human)
• Uniprot:
  • AAH24285(Human)