GRB10 Antibody (1A7)

Images

 
Western Blot: GRB10 Antibody (1A7) [H00002887-M01] - GRB10 monoclonal antibody (M01), clone 1A7. Analysis of GRB10 expression in IMR-32.
Sandwich ELISA: GRB10 Antibody (1A7) [H00002887-M01] - Detection limit for recombinant GST tagged GRB10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GRB10 Antibody (1A7) Summary

Immunogen
GRB10 (AAH24285, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS
Specificity
GRB10 - growth factor receptor-bound protein 10
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRB10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRB10 Antibody (1A7)

  • GRB10 adapter protein
  • GRB10 adaptor protein
  • Grb-10
  • GRBIR
  • GRB-IR
  • growth factor receptor-bound protein 10
  • Insulin receptor-binding protein Grb-IR
  • IRBP
  • KIAA0207
  • maternally expressed gene 1
  • MEG1
  • RSS

Background

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93946
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
291-G1
Species: Hu
Applications: BA
285-IF
Species: Hu
Applications: BA
NBP1-56853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
292-G2
Species: Hu
Applications: BA
210-TA
Species: Hu
Applications: BA
AF4856
Species: Hu, Mu, Rt
Applications: IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-97218
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DY421
Species: Mu
Applications: ELISA

Publications for GRB10 Antibody (H00002887-M01) (0)

There are no publications for GRB10 Antibody (H00002887-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB10 Antibody (H00002887-M01) (0)

There are no reviews for GRB10 Antibody (H00002887-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRB10 Antibody (H00002887-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRB10 Products

Bioinformatics Tool for GRB10 Antibody (H00002887-M01)

Discover related pathways, diseases and genes to GRB10 Antibody (H00002887-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRB10 Antibody (H00002887-M01)

Discover more about diseases related to GRB10 Antibody (H00002887-M01).
 

Pathways for GRB10 Antibody (H00002887-M01)

View related products by pathway.

PTMs for GRB10 Antibody (H00002887-M01)

Learn more about PTMs related to GRB10 Antibody (H00002887-M01).
 

Research Areas for GRB10 Antibody (H00002887-M01)

Find related products by research area.

Blogs on GRB10

There are no specific blogs for GRB10, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRB10 Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB10
Entrez
OMIM
Uniprot