Granzyme M Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining in human lymph node and cerebral cortex tissues using anti-GZMM antibody. Corresponding GZMM RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: Granzyme M Antibody [NBP2-14079] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Granzyme M Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Granzyme M Antibody - BSA Free (NBP2-14079) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GZMM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Granzyme M Protein (NBP2-14079PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Granzyme M Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• granzyme M (lymphocyte met-ase 1)
• granzyme M
• Hu-Met-1
• LMET1
• lymphocyte met-ase 1
• Met-1 serine protease
• MET1met-ase
• Met-ase
• Natural killer cell granular protease

Background

The GZMM gene encodes a 257 amino acid long, 27 kDA granzyme M protein that cleaves peptide substrates after methionine, leucine, and norleucine. In doing so, it encourages caspase activation and apoptosis of target cells. GZMM has been investigated for its role in arrhythmogenic right ventricular dysplasia as it participates in the immune system, alternative complement activation, and granzyme pathways. It is known to interact with genes CASP3, DFFA, EZR, NPM1, and PAK2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GZMM