Granzyme K Antibody


Western Blot: granzyme K Antibody [NBP1-69353] - This Anti-GZMK antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Granzyme K Antibody Summary

Synthetic peptides corresponding to GZMK(granzyme K (granzyme 3; tryptase II)) The peptide sequence was selected from the N terminal of Granzyme K. Peptide sequence PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GZMK and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Granzyme K Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC
  • Fragmentin-3
  • Granzyme 3
  • granzyme K (granzyme 3; tryptase II)
  • granzyme K (serine protease, granzyme 3; tryptase II)
  • Granzyme K
  • Granzyme-3
  • Granzyme-K
  • GZMK
  • NK-Tryp-2
  • NK-Tryptase-2
  • PRSS
  • TRYP2
  • TRYP2granzyme-3
  • Tryptase II


Granzyme K is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Granzyme K Antibody (NBP1-69353) (0)

There are no publications for Granzyme K Antibody (NBP1-69353).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme K Antibody (NBP1-69353) (0)

There are no reviews for Granzyme K Antibody (NBP1-69353). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme K Antibody (NBP1-69353) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Granzyme K Products

Bioinformatics Tool for Granzyme K Antibody (NBP1-69353)

Discover related pathways, diseases and genes to Granzyme K Antibody (NBP1-69353). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme K Antibody (NBP1-69353)

Discover more about diseases related to Granzyme K Antibody (NBP1-69353).

Pathways for Granzyme K Antibody (NBP1-69353)

View related products by pathway.

PTMs for Granzyme K Antibody (NBP1-69353)

Learn more about PTMs related to Granzyme K Antibody (NBP1-69353).

Blogs on Granzyme K

There are no specific blogs for Granzyme K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Granzyme K Antibody and receive a gift card or discount.


Gene Symbol GZMK