GRAIL/RNF128 Antibody

Images

 
Immunohistochemistry-Paraffin: GRAIL/RNF128 Antibody [NBP2-13237] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRAIL/RNF128 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNS ASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVA VDVIPHVDNPTFEEDETPNQETA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF128
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRAIL/RNF128 Protein (NBP2-13237PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRAIL/RNF128 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ23516
  • Gene related to anergy in lymphocytes protein
  • GRAIL
  • ring finger protein 128GRAILE3 ubiquitin-protein ligase RNF128
  • RNF128

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-68142
Species: Hu
Applications: WB, PEP-ELISA
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for GRAIL/RNF128 Antibody (NBP2-13237) (0)

There are no publications for GRAIL/RNF128 Antibody (NBP2-13237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRAIL/RNF128 Antibody (NBP2-13237) (0)

There are no reviews for GRAIL/RNF128 Antibody (NBP2-13237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GRAIL/RNF128 Antibody (NBP2-13237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRAIL/RNF128 Products

Bioinformatics Tool for GRAIL/RNF128 Antibody (NBP2-13237)

Discover related pathways, diseases and genes to GRAIL/RNF128 Antibody (NBP2-13237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRAIL/RNF128 Antibody (NBP2-13237)

Discover more about diseases related to GRAIL/RNF128 Antibody (NBP2-13237).
 

Pathways for GRAIL/RNF128 Antibody (NBP2-13237)

View related products by pathway.

PTMs for GRAIL/RNF128 Antibody (NBP2-13237)

Learn more about PTMs related to GRAIL/RNF128 Antibody (NBP2-13237).

Blogs on GRAIL/RNF128

There are no specific blogs for GRAIL/RNF128, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRAIL/RNF128 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF128
Entrez