GPT2 Antibody

Product Discontinued

GPT2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to GPT2(glutamic pyruvate transaminase (alanine aminotransferase) 2) The peptide sequence was selected from the C terminal of GPT2. Peptide sequence EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against GPT2 and was validated on Western blot.
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPT2 Antibody

• AAT2
• alanine aminotransferase 2
• ALT2EC 2.6.1.2
• Glutamate pyruvate transaminase 2
• glutamic pyruvate transaminase (alanine aminotransferase) 2
• Glutamic--alanine transaminase 2
• glutamic-pyruvate transaminase 2
• Glutamic--pyruvic transaminase 2
• GPT 2

Background

GPT and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPT2
• Uniprot:
  • Q8TD30(Human)