GPR81 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 250-346 of human GPR81 (NP_115943.1). SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HCAR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GPR81 Antibody - Azide and BSA Free
Background
The receptor FKSG80/GPR81 is a member of the Chemokine Receptor subfamily. FKSG80/GPR81 has been reported primarily in adipose and pituitary. ESTs for FKSG80/GPR81 have been isolated from human bladder cancer and colon cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, KD
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Publications for GPR81 Antibody (NBP3-15999) (0)
There are no publications for GPR81 Antibody (NBP3-15999).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR81 Antibody (NBP3-15999) (0)
There are no reviews for GPR81 Antibody (NBP3-15999).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR81 Antibody (NBP3-15999) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR81 Products
Research Areas for GPR81 Antibody (NBP3-15999)
Find related products by research area.
|
Blogs on GPR81