GPR81 Antibody - Azide and BSA Free

Western Blot: GPR81 Antibody [NBP3-15999] - Analysis of Mouse brain, using HCAR1 antibody at 1:700 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR81 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GPR81 Antibody - Azide and BSA Free (NBP3-15999) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-346 of human GPR81 (NP_115943.1). SACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HCAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for GPR81 Antibody - Azide and BSA Free

• FKSG80
• G protein-coupled receptor 104
• G protein-coupled receptor 81
• GPR104
• GPR81
• G-protein coupled receptor 104
• G-protein coupled receptor 81
• HCA1
• HCAR1
• LACR1
• lactate receptor 1
• TA-GPCR
• T-cell activation G protein-coupled receptor

Background

The receptor FKSG80/GPR81 is a member of the Chemokine Receptor subfamily. FKSG80/GPR81 has been reported primarily in adipose and pituitary. ESTs for FKSG80/GPR81 have been isolated from human bladder cancer and colon cancer libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HCAR1