GPR162 Antibody

Western Blot: GPR162 Antibody [NBP3-09608] - Western blot analysis of GPR162 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GPR162 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR162 (NP_062832). Peptide sequence ILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTFAVVQLRRQASSDYD
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR162
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR162 Antibody

• A-2
• FLJ78837
• G protein-coupled receptor 162
• Gene-rich cluster gene A protein
• GPR162
• GRCA
• GRCAgene rich cluster, A
• probable G-protein coupled receptor 162

Background

GPR162, also known as Probable G-protein coupled receptor 162, has a 588 amino acid long isoform that is 64 kDa and a short 304 amino acid isoform that is 33 kDa, located in the cell membrane, mainly expressed in the brain; acts as an orphan receptor. This protein is being studied for its involvement in St. Louis encephalitis, amyotrophic lateral sclerosis, lymphoma, asphyxia neonatorum, dental caries, spotted fever, typhus, lyme disease, toxic shock syndrome, cystic fibrosis, purpura, pancreatic cancer, and pancreatitis. It has been inferred that GPR162 protein is involved in G-protein coupled receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR162