GPR162 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR162 (NP_062832). Peptide sequence ILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTFAVVQLRRQASSDYD |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GPR162 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS buffer, 2% sucrose. |
Preservative |
0.09% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for GPR162 Antibody
Background
GPR162, also known as Probable G-protein coupled receptor 162, has a 588 amino acid long isoform that is 64 kDa and a short 304 amino acid isoform that is 33 kDa, located in the cell membrane, mainly expressed in the brain; acts as an orphan receptor. This protein is being studied for its involvement in St. Louis encephalitis, amyotrophic lateral sclerosis, lymphoma, asphyxia neonatorum, dental caries, spotted fever, typhus, lyme disease, toxic shock syndrome, cystic fibrosis, purpura, pancreatic cancer, and pancreatitis. It has been inferred that GPR162 protein is involved in G-protein coupled receptor signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for GPR162 Antibody (NBP3-09608) (0)
There are no publications for GPR162 Antibody (NBP3-09608).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR162 Antibody (NBP3-09608) (0)
There are no reviews for GPR162 Antibody (NBP3-09608).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR162 Antibody (NBP3-09608) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR162 Products
Bioinformatics Tool for GPR162 Antibody (NBP3-09608)
Discover related pathways, diseases and genes to GPR162 Antibody (NBP3-09608). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GPR162 Antibody (NBP3-09608)
Discover more about diseases related to GPR162 Antibody (NBP3-09608).
|
Research Areas for GPR162 Antibody (NBP3-09608)
Find related products by research area.
|
Blogs on GPR162