GPR109B/HM74 Antibody - BSA Free

Immunohistochemistry: GPR109B/HM74 Antibody [NBP3-35830] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using GPR109B/HM74 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: GPR109B/HM74 Antibody [NBP3-35830] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using GPR109B/HM74 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: GPR109B/HM74 Antibody [NBP3-35830] - Western blot analysis of lysates from Rat pancreas, using GPR109B/HM74 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 120s.

Immunohistochemistry: GPR109B/HM74 Antibody [NBP3-35830] - Immunohistochemistry analysis of paraffin-embedded Human spleen using GPR109B/HM74 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR109B/HM74 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-392 of human GPR109B/HM74 (NP_006009.2).
  
  Sequence:
  SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HCAR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for GPR109B/HM74 Antibody - BSA Free

• G protein-coupled receptor 109B
• GPR109B
• G-protein coupled receptor 109B
• G-protein coupled receptor HM74
• G-protein coupled receptor HM74B
• GTP-binding protein
• HCA3
• HCAR3
• HM74
• HM74B
• HM74Puma-g
• Niacin receptor 2
• NIACR2
• Nicotinic acid receptor 2
• PUMAG
• putative chemokine receptor

Background

HM74 is a Nicotinic Acid GPCR. HM74 expression has been reported in adipose and spleen, as well as lymphocytes and monocytes. ESTs have been isolated from adipose, blood, liver, liver/spleen, placenta, prostate, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HCAR3