GPM6B Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPM6B. Peptide sequence: ETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPM6B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GPM6B Antibody - BSA Free
Background
The GPM6B gene encodes a membrane glycoprotein that belongs to the proteolipid protein family. Proteolipid protein familymembers are expressed in most brain regions and are thought to be involved in cellular housekeeping functions, such asmembrane trafficking
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ch, Gt, Hu, Mu, Po, Rt, Xp
Applications: IHC, IHC-P, WB
Publications for GPM6B Antibody (NBP2-82921) (0)
There are no publications for GPM6B Antibody (NBP2-82921).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPM6B Antibody (NBP2-82921) (0)
There are no reviews for GPM6B Antibody (NBP2-82921).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPM6B Antibody (NBP2-82921) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPM6B Products
Research Areas for GPM6B Antibody (NBP2-82921)
Find related products by research area.
|
Blogs on GPM6B