GPIP137 Antibody [Alexa Fluor® 405]

Product Discontinued

GPIP137 Antibody [Alexa Fluor® 405] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GPIP137 (NP_005889.3).
  
  Sequence:
  AEEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQPNQVPVQPEATQVPLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPRIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GPIP137 Antibody [Alexa Fluor® 405]

• activation/proliferation-associated protein 1
• caprin 1
• caprin-1
• cell cycle associated protein 1
• Cell cycle-associated protein 1
• Cytoplasmic activation- and proliferation-associated protein 1
• cytoplasmic activation/proliferation-associated protein-1
• GPI-anchored membrane protein 1GPIP137
• GPI-p137
• M11S1GPI-anchored protein p137
• Membrane component chromosome 11 surface marker 1
• membrane component, chromosome 11, surface marker 1
• p137GPI
• RNA granule protein 105
• RNG105GPIAP1

Background

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPRIN1