GPI7 Antibody

Images

 
Immunohistochemistry: GPI7 Antibody [NBP1-89853] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPI7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPI7 Protein (NBP1-89853PEP)
Publications
Read Publication using NBP1-89853.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPI7 Antibody

  • DKFZp434A1810
  • DKFZp434C1712
  • EC 2.-
  • FLJ20265
  • FLJ39925
  • GPI ethanolamine phosphate transferase 2
  • GPI7 homolog
  • GPI7DKFZp434M1131
  • hGPI7
  • LAS21
  • MGC131903
  • phosphatidylinositol glycan anchor biosynthesis, class G
  • phosphatidylinositol glycan, class G
  • Phosphatidylinositol-glycan biosynthesis class G protein
  • PIG-G
  • PRO4405
  • RLGS1930

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-86849
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-69261
Species: Hu
Applications: WB, IHC
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00010380-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91706
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2751
Species: Hu
Applications: WB, ChIP, ELISA, Func, ICC/IF, IHC, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB120-2805
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP

Publications for GPI7 Antibody (NBP1-89853)(1)

Reviews for GPI7 Antibody (NBP1-89853) (0)

There are no reviews for GPI7 Antibody (NBP1-89853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPI7 Antibody (NBP1-89853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPI7 Products

GPI7 NBP1-89853

Bioinformatics Tool for GPI7 Antibody (NBP1-89853)

Discover related pathways, diseases and genes to GPI7 Antibody (NBP1-89853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPI7 Antibody (NBP1-89853)

Discover more about diseases related to GPI7 Antibody (NBP1-89853).
 

Pathways for GPI7 Antibody (NBP1-89853)

View related products by pathway.

Blogs on GPI7

There are no specific blogs for GPI7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPI7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGG