BRP44L Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining in human heart muscle and pancreas tissues.. Corresponding MPC1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Western Blot: BRP44L Antibody [NBP1-91706] - Analysis in human cell lines HEK293 and A-549 using anti-MPC1 antibody. Corresponding MPC1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: BRP44L Antibody [NBP1-91706] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human kidney shows moderate to strong positivity in mitochondria in cells in tubules.
Western Blot: BRP44L Antibody [NBP1-91706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human duodenum shows strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human pancreas shows weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human salivary gland shows strong positivity in mitochondria in ductal cells.
Western Blot: BRP44L Antibody [NBP1-91706] - Characterization of MPC1−/− in the RM-1 murine prostate cancer cells(A) Shows representative sequencings of the MPC1 PCR products in WT & MPC1−/− cells. The upper ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

BRP44L Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRP44L Protein (NBP1-91706PEP)
Publications
Read Publications using
NBP1-91706 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28624784).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BRP44L Antibody - BSA Free

  • brain protein 44-like protein
  • brain protein 44-like
  • BRP44L
  • CGI-129
  • dJ68L15.3
  • HSPC040 protein
  • HSPC040
  • MPC1
  • PNAS-115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31623
Species: Hu
Applications: IHC,  IHC-P
NBP1-89853
Species: Hu
Applications: IHC,  IHC-P
NBP1-80819
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-89501
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
1129-ER
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-25265
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP2-94216
Species: Hu, Mu, Rt
Applications: WB
NBP1-91706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO

Publications for BRP44L Antibody (NBP1-91706)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(5)
All Applications
Filter By Species
Human
(4)
Mouse
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-91706 Applications Species
Li M, Plecitá-Hlavatá L, Dobrinskikh E et al. SIRT3 Is a Critical Regulator of Mitochondrial Function of Fibroblasts in Pulmonary Hypertension American journal of respiratory cell and molecular biology 2023-06-21 [PMID: 37343939]
Liu Y, Yuan Y, Yan Y et al. Mitochondrial pyruvate carrier 1 alleviates hypoxic-ischemic brain injury in rats Life sciences 2023-04-06 [PMID: 37030616]
You JH, Lee J, Roh JL Mitochondrial pyruvate carrier 1 regulates ferroptosis in drug-tolerant persister head and neck cancer cells via epithelial-mesenchymal transition Cancer letters 2021-03-16 [PMID: 33741422] (WB) WB
Kim J, Yu L, Chen W et al. Wild-Type p53 Promotes Cancer Metabolic Switch by Inducing PUMA-Dependent Suppression of Oxidative Phosphorylation Cancer Cell 2019-02-11 [PMID: 30712844] (ICC/IF, Human) ICC/IF Human
Li X, Han G, Li X et al. Mitochondrial pyruvate carrier function determines cell stemness and metabolic reprogramming in cancer cells Oncotarget 2017-07-11 [PMID: 28624784] (WB, Mouse) WB Mouse
Li X, Ji Y, Han G et al. MPC1 and MPC2 expressions are associated with favorable clinical outcomes in prostate cancer. BMC Cancer. 2016-11-16 [PMID: 27852261] (WB, Human) WB Human
Li Y, Li X, et al. PDHA1 gene knockout in prostate cancer cells results in metabolic reprogramming towards greater glutamine dependence. Oncotarget 2016-08-16 [PMID: 27462778] (WB, Human) WB Human
Konstantakou EG, Voutsinas GE, Velentzas AD et al. 3-BrPA eliminates human bladder cancer cells with highly oncogenic signatures via engagement of specific death programs and perturbation of multiple signaling and metabolic determinants Mol. Cancer. 2015-07-22 [PMID: 26198749] (WB, Human) WB Human

Reviews for BRP44L Antibody (NBP1-91706) (0)

There are no reviews for BRP44L Antibody (NBP1-91706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRP44L Antibody (NBP1-91706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRP44L Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MPC1