Orthogonal Strategies: Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining in human heart muscle and pancreas tissues.. Corresponding MPC1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Western Blot: BRP44L Antibody [NBP1-91706] - Analysis in human cell lines HEK293 and A-549 using anti-MPC1 antibody. Corresponding MPC1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: BRP44L Antibody [NBP1-91706] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human kidney shows moderate to strong positivity in mitochondria in cells in tubules.
Western Blot: BRP44L Antibody [NBP1-91706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human duodenum shows strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human pancreas shows weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human salivary gland shows strong positivity in mitochondria in ductal cells.
Western Blot: BRP44L Antibody [NBP1-91706] - Characterization of MPC1−/− in the RM-1 murine prostate cancer cells(A) Shows representative sequencings of the MPC1 PCR products in WT & MPC1−/− cells. The upper ...read more
Novus Biologicals Knockout (KO) Validated Rabbit BRP44L Antibody - BSA Free (NBP1-91706) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BRP44L Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 28624784).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for BRP44L Antibody - BSA Free
brain protein 44-like protein
brain protein 44-like
BRP44L
CGI-129
dJ68L15.3
HSPC040 protein
HSPC040
MPC1
PNAS-115
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our BRP44L Antibody - BSA Free and receive a gift card or discount.