BRP44L Antibody - BSA Free

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining in human heart muscle and pancreas tissues.. Corresponding MPC1 RNA-seq data are presented for the same tissues.

Western Blot: BRP44L Antibody [NBP1-91706] - Analysis in human cell lines HEK293 and A-549 using anti-MPC1 antibody. Corresponding MPC1 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.

Immunocytochemistry/Immunofluorescence: BRP44L Antibody [NBP1-91706] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human kidney shows moderate to strong positivity in mitochondria in cells in tubules.

Western Blot: BRP44L Antibody [NBP1-91706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human duodenum shows strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human pancreas shows weak positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human salivary gland shows strong positivity in mitochondria in ductal cells.

Western Blot: BRP44L Antibody [NBP1-91706] - Characterization of MPC1−/− in the RM-1 murine prostate cancer cells(A) Shows representative sequencings of the MPC1 PCR products in WT & MPC1−/− cells. The upper panel shows a representative MPC1 PCR product sequencing chart of WT cells at the left part, & the right part on the upper panel shows the full cDNA sequence & the speculated amino acids (110 amino acids). The left part on the lower panel shows a representative MPC1 PCR product of the MPC1−/− cells, which reveals double sets of peak. The right part of the lower panel shows the mutated DNA sequences at both alleles, on which one allele on the upper part has a two-base “at” deletion (green arrow), while another allele on the lower part harbors one base “a” insertion (red arrow). Both mutated sequences create an early terminator “tga”, which results in only 1/3 of the translation (41 amino acids in the upper allele & 42 amino cods in another allele). (B) The IF & IHC results. Co-localization of MPC1 or MPC2 & the mitochondrial protein MT-CO1 are shown in the WT RM-1 cells, while there is no MPC1 protein expression revealed by either IF or ICC in the MPC1−/− cells. There was only weak MPC2 protein expression in the MPC1−/− cells revealed by ICC. Scale bars, 200 μm. Western blotting results of subcellular proteins from WT & MPC1−/− cells & corresponding densitometry histograms of ALT1 & PC are shown in (C). Cyto means cytoplasmic protein. Mito stands for mitochondrial protein. Protein alpha -Tublin was used as a loading control. ***PLane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRP44L Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit BRP44L Antibody - BSA Free (NBP1-91706) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BRP44L Antibody: Cited in 8 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BRP44L Protein (NBP1-91706PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28624784).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BRP44L Antibody - BSA Free

• brain protein 44-like protein
• brain protein 44-like
• BRP44L
• CGI-129
• dJ68L15.3
• HSPC040 protein
• HSPC040
• MPC1
• PNAS-115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BRP44L Antibody (NBP1-91706)(8)

Publications using NBP1-91706

• Li M, Plecitá-Hlavatá L, Dobrinskikh E et al. SIRT3 Is a Critical Regulator of Mitochondrial Function of Fibroblasts in Pulmonary Hypertension American journal of respiratory cell and molecular biology 2023-06-21 [PMID: 37343939]
• Liu Y, Yuan Y, Yan Y et al. Mitochondrial pyruvate carrier 1 alleviates hypoxic-ischemic brain injury in rats Life sciences 2023-04-06 [PMID: 37030616]
• You JH, Lee J, Roh JL Mitochondrial pyruvate carrier 1 regulates ferroptosis in drug-tolerant persister head and neck cancer cells via epithelial-mesenchymal transition Cancer letters 2021-03-16 [PMID: 33741422] (WB)
• Kim J, Yu L, Chen W et al. Wild-Type p53 Promotes Cancer Metabolic Switch by Inducing PUMA-Dependent Suppression of Oxidative Phosphorylation Cancer Cell 2019-02-11 [PMID: 30712844] (ICC/IF, Human)
• Li X, Han G, Li X et al. Mitochondrial pyruvate carrier function determines cell stemness and metabolic reprogramming in cancer cells Oncotarget 2017-07-11 [PMID: 28624784] (WB, Mouse)
• Li X, Ji Y, Han G et al. MPC1 and MPC2 expressions are associated with favorable clinical outcomes in prostate cancer. BMC Cancer. 2016-11-16 [PMID: 27852261] (WB, Human)
• Li Y, Li X, et al. PDHA1 gene knockout in prostate cancer cells results in metabolic reprogramming towards greater glutamine dependence. Oncotarget 2016-08-16 [PMID: 27462778] (WB, Human)
• Konstantakou EG, Voutsinas GE, Velentzas AD et al. 3-BrPA eliminates human bladder cancer cells with highly oncogenic signatures via engagement of specific death programs and perturbation of multiple signaling and metabolic determinants Mol. Cancer. 2015-07-22 [PMID: 26198749] (WB, Human)

Bioinformatics

• Gene Symbol: MPC1