Recombinant Human GPER/GPR30 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPER/GPR30 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-375 of Human GPR30 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GPER
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPER/GPR30 Protein

  • CEPR
  • CEPRG-protein coupled receptor 30
  • Chemoattractant receptor-like 2
  • chemokine receptor-like 2
  • CMKRL2
  • CMKRL2MGC99678
  • constitutively expressed peptide-like receptor
  • DRY12
  • DRY12IL8-related receptor DRY12
  • FEG-1
  • FEG-1mER
  • Flow-induced endothelial G-protein coupled receptor 1
  • G protein-coupled estrogen receptor 1
  • G protein-coupled receptor 30
  • GPCR-BR
  • GPER
  • GPR30
  • GPR30GPCR-Br
  • G-protein coupled estrogen receptor 1
  • heptahelix receptor
  • LERGU
  • LERGU2
  • leucine rich protein in GPR30 3'UTR
  • LyGPR
  • Lymphocyte-derived G-protein coupled receptor
  • Membrane estrogen receptor

Background

This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
AF885
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GPER/GPR30 Recombinant Protein (H00002852-P01) (0)

There are no publications for GPER/GPR30 Recombinant Protein (H00002852-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPER/GPR30 Recombinant Protein (H00002852-P01) (0)

There are no reviews for GPER/GPR30 Recombinant Protein (H00002852-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPER/GPR30 Recombinant Protein (H00002852-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPER/GPR30 Products

Bioinformatics Tool for GPER/GPR30 Recombinant Protein (H00002852-P01)

Discover related pathways, diseases and genes to GPER/GPR30 Recombinant Protein (H00002852-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPER/GPR30 Recombinant Protein (H00002852-P01)

Discover more about diseases related to GPER/GPR30 Recombinant Protein (H00002852-P01).
 

Pathways for GPER/GPR30 Recombinant Protein (H00002852-P01)

View related products by pathway.

PTMs for GPER/GPR30 Recombinant Protein (H00002852-P01)

Learn more about PTMs related to GPER/GPR30 Recombinant Protein (H00002852-P01).
 

Research Areas for GPER/GPR30 Recombinant Protein (H00002852-P01)

Find related products by research area.

Blogs on GPER/GPR30

There are no specific blogs for GPER/GPR30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPER/GPR30 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPER
Entrez