Recombinant Human Gonadotropin Inducible Transcription Repressor 1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Gonadotropin Inducible Transcription Repressor 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 563 of Human ZNF461 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZNF461
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
92.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gonadotropin Inducible Transcription Repressor 1 Protein

  • zinc finger protein 213
  • Zinc finger protein with KRAB and SCAN domains 21
  • ZKSCAN21CR53Putative transcription factor CR53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Pm
Applications: WB, IHC-P
NBP2-49069
Species: Hu
Applications: IHC, IHC-P
NBP2-38243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
PP-H7431-00
Species: Hu
Applications: WB
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA, CHIP-SEQ
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-90592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06661
Species: Hu
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002790-P01
Species: Hu
H00092283-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01) (0)

There are no publications for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01) (0)

There are no reviews for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gonadotropin Inducible Transcription Repressor 1 Products

Bioinformatics Tool for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01)

Discover related pathways, diseases and genes to Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01)

Discover more about diseases related to Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01).
 

Pathways for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01)

View related products by pathway.

PTMs for Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01)

Learn more about PTMs related to Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein (H00092283-P01).

Blogs on Gonadotropin Inducible Transcription Repressor 1

There are no specific blogs for Gonadotropin Inducible Transcription Repressor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gonadotropin Inducible Transcription Repressor 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF461