GOLGA7 Antibody (2H8)

Images

 
Western Blot: GOLGA7 Antibody (2H8) [H00051125-M01] - GOLGA7 monoclonal antibody (M01), clone 2H8 Analysis of GOLGA7 expression in HL-60.
Immunoprecipitation: GOLGA7 Antibody (2H8) [H00051125-M01] - Analysis of GOLGA7 transfected lysate using anti-GOLGA7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLGA7 monoclonal antibody.
ELISA: GOLGA7 Antibody (2H8) [H00051125-M01] - Detection limit for recombinant GST tagged GOLGA7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GOLGA7 Antibody (2H8) Summary

Immunogen
GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Specificity
GOLGA7 - golgi autoantigen, golgin subfamily a, 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GOLGA7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00051125-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GOLGA7 Antibody (2H8)

  • GCP16MGC21096
  • GOLGA3AP1
  • GOLGA7A
  • golgi autoantigen, golgin subfamily a, 7
  • Golgi complex-associated protein of 16 kDa
  • Golgi complex-associated protein of 16kDa
  • golgin A7
  • Golgin subfamily A member 7
  • HSPC041
  • MGC4876

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12368
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-91953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-83654
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP2-22321
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-13541
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-56360
Species: Hu
Applications: WB
NB100-56500
Species: Ca, Ch, Hu, Pm, Rt
Applications: IHC, IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
H00007994-M07
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00051125-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP

Publications for GOLGA7 Antibody (H00051125-M01)(1)


Reviews for GOLGA7 Antibody (H00051125-M01) (0)

There are no reviews for GOLGA7 Antibody (H00051125-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GOLGA7 Antibody (H00051125-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GOLGA7 Products

Bioinformatics Tool for GOLGA7 Antibody (H00051125-M01)

Discover related pathways, diseases and genes to GOLGA7 Antibody (H00051125-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA7 Antibody (H00051125-M01)

Discover more about diseases related to GOLGA7 Antibody (H00051125-M01).
 

Pathways for GOLGA7 Antibody (H00051125-M01)

View related products by pathway.

PTMs for GOLGA7 Antibody (H00051125-M01)

Learn more about PTMs related to GOLGA7 Antibody (H00051125-M01).

Blogs on GOLGA7

There are no specific blogs for GOLGA7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLGA7 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA7
Entrez
OMIM
Uniprot