Home » GOLGA7 » GOLGA7 Antibodies » GOLGA7 Antibody (2H8)

GOLGA7 Antibody (2H8)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GOLGA7 Antibody (2H8) [H00051125-M01] - GOLGA7 monoclonal antibody (M01), clone 2H8 Analysis of GOLGA7 expression in HL-60.
Western Blot: GOLGA7 Antibody (2H8) [H00051125-M01] - GOLGA7 monoclonal antibody (M01), clone 2H8 Analysis of GOLGA7 expression in HL-60.
Immunoprecipitation: GOLGA7 Antibody (2H8) [H00051125-M01] - Analysis of GOLGA7 transfected lysate using anti-GOLGA7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLGA7 monoclonal antibody.
ELISA: GOLGA7 Antibody (2H8) [H00051125-M01] - Detection limit for recombinant GST tagged GOLGA7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GOLGA7 Antibody (2H8) Summary

Immunogen
GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Specificity
GOLGA7 - golgi autoantigen, golgin subfamily a, 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GOLGA7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00051125-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GOLGA7 Antibody (2H8)

  • GCP16MGC21096
  • GOLGA3AP1
  • GOLGA7A
  • golgi autoantigen, golgin subfamily a, 7
  • Golgi complex-associated protein of 16 kDa
  • Golgi complex-associated protein of 16kDa
  • golgin A7
  • Golgin subfamily A member 7
  • HSPC041
  • MGC4876

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZDHHC9 Antibody
NBP3-12368
Western Blot: ZDHHC9 Antibody [NBP3-12368] - 1). Rat skeletal muscle, 2). Rat cortex, 3). Rat spinal cord. Dilution 1:500 in DiluObuffer. Apparent MW is 48 KDa. Blot was obtained at higher antibody concentrations to detect appearnce of non-specific bands.
Immunohistochemistry-Paraffin: ZDHHC9 Antibody [NBP3-12368] - Mouse kidney. 1:50 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40x magnification.
Immunohistochemistry-Paraffin: ZDHHC9 Antibody [NBP3-12368] - Mouse Liver. 1:50 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 10x magnification.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
GOLGA3 Antibody
NBP1-91953
Immunocytochemistry/Immunofluorescence: GOLGA3 Antibody [NBP1-91953] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91953] - Staining of human colon, prostate, testis and tonsil using Anti-GOLGA3 antibody NBP1-91953 (A) shows similar protein distribution across tissues to independent antibody NBP1-91952 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
TIS11D Antibody
NBP2-83654
Immunohistochemistry: TIS11D Antibody [NBP2-83654] - Immunohistochemistry with Skin, dermal fibroblasts tissue at an antibody concentration of 5ug/ml using anti-ZFP36L2 antibody
Western Blot: TIS11D Antibody [NBP2-83654] - Host: Rabbit. Target Name: ZFP36L2. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: TIS11D Antibody [NBP2-83654] - WB Suggested Anti-ZFP36L2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysate
Species: Hu
Applications: IHC, IHC-P, WB
GOLPH3 Antibody
NBP2-75515
Flow Cytometry: GOLPH3 Antibody [NBP2-75515] - Analysis of Hela cells with GOLPH3 antibody at 1/100 dilution (green) compared with an unlabelled control (cells without incubation with primary antibody; red).
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-75515] - Staining GOLPH3 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-75515] - Staining GOLPH3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
GOLGB1/Giantin
Antibody
NBP2-22321
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Untreated MDA-MB-231 cells showed perinuclear colonization of Giantin and other proteins, demonstrating this cell line exhibits the architecture of a typical Golgi apparatus. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. Secondary antibodies in other channels. Nuclei were stained with DAPI (gray channel). Fluorescence microscopy was used to examine stained cells. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Effect of ActD on the perinuclear localization of the Golgi apparatus of MDA-MB-231 cells assessed by immunofluorescence to Giantin, GM130 and TGN46. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP2-22321] - Shows the combination effects of antitumor drugs and ARF1 disruptors on the MDA-MB-231 cells Golgi apparatus. Cells were fixed, permeabilized, and immunolabeled with rabbit polyclonal antibody to Giantin. The final row is a merged image form the previous 3 rows. Overlapping of different combinations of rows indicated in different colors. Bar: 10 um.Citation: Luchsinger C, Aguilar M, Burgos PV, Ehrenfeld P, Mardones GA (2018) Functional disruption of the Golgi apparatus protein ARF1 sensitizes MDA-MB-231 breast cancer cells to the antitumor drugs Actinomycin D and Vinblastine through ERK and AKT signaling. PLoS ONE 13(4): e0195401.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: ICC/IF, IP, WB
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
ZDHHC2 Antibody
NBP2-13541
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Simple Western lane view shows a specific band for ZDHHC2 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Electropherogram image(s) of corresponding Simple Western lane view. ZDHHC2 antibody was used at 1:20 dilution on Liver lysate(s).
Immunohistochemistry-Paraffin: ZDHHC2 Antibody [NBP2-13541] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
GAP-43 Antibody
NB300-143
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Posterior MOE sections at approximately the same region where EOG was recorded were obtained from control and Skn-1a-/- mice exposed to either water or chemicals for 2 wks. The sections were immunoreacted with antibodies against GAP43 and OMP and stained with DAPI. Confocal images were taken from olfactory turbinate II. Similar morphology and marker expression were found in four groups of mice, indicating there was no obvious tissue damage in both control and Skn-1a-/- mice after chemical exposure in the posterior MOE regions where EOG recordings were performed. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (http://eneuro.sfn.org/lookup/doi/10.1523/ENEURO.0135-17.2017), licensed under a CC-BY licence.
(1 Review)
(82 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 50 ng/mL Human PDGF-BB (Catalog # 220-BB) for 20 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse Phospho-SHP‑2 (Y542) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3790), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-SHP‑2 (Y542) at approximately 72 kDa (as indicated). The lysates were also probed for total SHP-2 with Human/Mouse/Rat SHP-2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1894). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 50 ng/mL Recombinant Human PDGF‑BB (Catalog # 220-BB) for 20 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-SHP‑2 (Y542) at approximately 72 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human/Mouse Phospho-SHP‑2 (Y542) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3790). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Publication)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
CBL Antibody (3B12)
NBP2-37574
ELISA: CBL Antibody (3B12) [NBP2-37574] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mAb against human C-CBL (AA: 684-865) recombinant protein. (Expected MW is 44.9 kDa)
Western Blot: CBL Antibody (3B12) [NBP2-37574] - Western blot analysis using C-CBL mouse mAb against RAJI (1), RAW264.7 (2), K562 (3), SKBR-3 (4), 3T3-L1 (5), THP-1 (6) and PC-12 (7) cell lysate.
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
IKK beta Antibody
(10AG2) - BSA Free
NB100-56509
Flow Cytometry: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of PE conjugate of NB100-56509. An intracellular stain was performed on Jurkat cells with IKK Beta antibody (10AG2) NB100-56509PE (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized wi
Immunocytochemistry/Immunofluorescence: IKK beta Antibody (10AG2) [NB100-56509] - U-87 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-IKK beta Antibody (10AG2) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: IKK beta Antibody (10AG2) [NB100-56509] - Analysis using the Alexa Fluor (R) 488 conjugate of NB100-56509. Staining of IKKbeta in HEK 293 cells using 0.1 ug of Alexa Fluor 488-conjugated antibody. Green histogram represents the isotype control , red represents the IKKbeta antibody.
(2 Reviews)
(57 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
UEV2 Antibody
NB100-56360
Western Blot: UEV2 Antibody [NB100-56360] - Detection of UBE2V2 in HL-60 cell lysate with anti-UBE2V2 pcAb this antibody at 2ug/ml.
Species: Hu
Applications: WB
FNTA Antibody
NB100-56500
Western Blot: FNTA Antibody [NB100-56500] - analysis of FNTA in mouse colon cell lysate in the 1) absence and 2) presence of immunizing peptide using FNTA antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: FNTA Antibody [NB100-56500] - analysis of human prostate using FNTA antibody at 10 ug/ml.
Species: Ca, Ch, Hu, Pm, Rt
Applications: IHC, IHC-P, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
MYST3 Antibody
(4D8)
H00007994-M07
Sandwich ELISA: MYST3 Antibody (4D8) [H00007994-M07] - Detection limit for recombinant GST tagged MYST3 is 0.3 ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: MYST3 Antibody (4D8) [H00007994-M07] - Analysis of monoclonal antibody to MYST3 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
GOLGA7 Antibody
(2H8)
H00051125-M01
GOLGA7 Antibody (2H8)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP

Publications for GOLGA7 Antibody (H00051125-M01)(1)


Reviews for GOLGA7 Antibody (H00051125-M01) (0)

There are no reviews for GOLGA7 Antibody (H00051125-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GOLGA7 Antibody (H00051125-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GOLGA7 Products

Bioinformatics Tool for GOLGA7 Antibody (H00051125-M01)

Discover related pathways, diseases and genes to GOLGA7 Antibody (H00051125-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA7 Antibody (H00051125-M01)

Discover more about diseases related to GOLGA7 Antibody (H00051125-M01).
 

Pathways for GOLGA7 Antibody (H00051125-M01)

View related products by pathway.

PTMs for GOLGA7 Antibody (H00051125-M01)

Learn more about PTMs related to GOLGA7 Antibody (H00051125-M01).

Blogs on GOLGA7

There are no specific blogs for GOLGA7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLGA7 Antibody (2H8) and receive a gift card or discount.


Bioinformatics

Gene Symbol GOLGA7
Entrez
OMIM
Uniprot