Home » GOLGA7 » GOLGA7 Antibodies » GOLGA7 Antibody (2H8)

GOLGA7 Antibody (2H8)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: GOLGA7 Antibody (2H8) [H00051125-M01] - GOLGA7 monoclonal antibody (M01), clone 2H8 Analysis of GOLGA7 expression in HL-60.
Western Blot: GOLGA7 Antibody (2H8) [H00051125-M01] - GOLGA7 monoclonal antibody (M01), clone 2H8 Analysis of GOLGA7 expression in HL-60.
Immunoprecipitation: GOLGA7 Antibody (2H8) [H00051125-M01] - Analysis of GOLGA7 transfected lysate using anti-GOLGA7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLGA7 monoclonal antibody.
ELISA: GOLGA7 Antibody (2H8) [H00051125-M01] - Detection limit for recombinant GST tagged GOLGA7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GOLGA7 Antibody (2H8) Summary

Immunogen
GOLGA7 (AAH12032, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
Specificity
GOLGA7 - golgi autoantigen, golgin subfamily a, 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GOLGA7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00051125-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GOLGA7 Antibody (2H8)

  • GCP16MGC21096
  • GOLGA3AP1
  • GOLGA7A
  • golgi autoantigen, golgin subfamily a, 7
  • Golgi complex-associated protein of 16 kDa
  • Golgi complex-associated protein of 16kDa
  • golgin A7
  • Golgin subfamily A member 7
  • HSPC041
  • MGC4876

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZDHHC9 Antibody
NBP1-84499
Immunocytochemistry/Immunofluorescence: ZDHHC9 Antibody [NBP1-84499] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: ZDHHC9 Antibody [NBP1-84499] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
GOLGA3 Antibody
NBP1-91952
Western Blot: GOLGA3 Antibody [NBP1-91952] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: GOLGA3 Antibody [NBP1-91952] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLGA3 Antibody [NBP1-91952] - Staining in human cerebral cortex and liver tissues using anti-GOLGA3 antibody. Corresponding GOLGA3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NRAS Antibody
NB100-94887
Western Blot: NRAS Antibody [NB100-94887] - (0.01ug/ml) staining of A431 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: NRAS Antibody [NB100-94887] - (2.5ug/ml) staining of paraffin embedded Human Small Intestine. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: NRAS Antibody [NB100-94887] - (0.1ug/ml) staining of Rat Intestines lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
TIS11D Antibody
NBP1-92510
Immunohistochemistry-Paraffin: TIS11D Antibody [NBP1-92510] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Species: Hu
Applications: IHC, IHC-P
GOLPH3 Antibody
NBP2-58286
Western Blot: GOLPH3 Antibody [NBP2-58286] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: GOLPH3 Antibody [NBP2-58286] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: GOLPH3 Antibody [NBP2-58286] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GOLGB1/Giantin
Antibody
NBP1-91937
Immunocytochemistry/Immunofluorescence: GOLGB1/Giantin Antibody [NBP1-91937] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GOLGB1/Giantin Antibody [NBP1-91937] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
vH RAS Antibody
(OTI1D9)
NBP2-45745
Western Blot: vH RAS Antibody (1D9) [NBP2-45745] - Analysis of extracts (35ug) from 9 different cell lines (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: vH RAS Antibody (1D9) [NBP2-45745] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: vH RAS Antibody (1D9) [NBP2-45745] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY vH RAS.
Species: Hu
Applications: WB, IHC, IF
ZDHHC2 Antibody
NBP2-13541
Immunohistochemistry-Paraffin: ZDHHC2 Antibody [NBP2-13541] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Simple Western lane view shows a specific band for ZDHHC2 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: ZDHHC2 Antibody [NBP2-13541] - Electropherogram image(s) of corresponding Simple Western lane view. ZDHHC2 antibody was used at 1:20 dilution on Liver lysate(s).
(1 Publication)
Species: Hu, Mu
Applications: Simple Western, IHC, IHC-P
GAP-43 Antibody
NB300-143
Western Blot: GAP-43 Antibody [NB300-143] - Different tissue and cell lysates using rabbit pAb to GAP43, dilution 1:20,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] SH-SY5Y cells, [7] C6 cells. Single band at 43 kDa mark corresponds to GAP43 protein. The GAP43 protein is detected only in the lysates of neuronal origin. C6 cells are a rat glioma cell line and do not express GAP43 protein
Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
Immunohistochemistry-Paraffin: GAP-43 Antibody [NB300-143] - Review image from confirmed customer on mouse E15.5 paraffin sections.
(1 Review)
(46 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P
Dengue virus NS1
protein Antibody
NBP2-54602
Western Blot: Dengue virus NS1 protein Antibody [NBP2-54602] - detects NS1 (Dengue virus) protein by western blot analysis.A. 30 ug BHK-21 whole cell extractB. 30 ug whole cell lysate/extract of Dengue virus type 2 infected BHK-21 cells10 % SDS-PAGE NS1 (Dengue virus) antibody dilution: 1:5000
Immunocytochemistry/Immunofluorescence: Dengue virus NS1 protein Antibody [NBP2-54602] - analysis of paraformaldehyde-fixed BHK-21 cell, using NS1 (Dengue virus 2) antibody at 1:2000 dilution.
Western Blot: Dengue virus NS1 protein Antibody [NBP2-54602] - A. 66 ug BHK-21 whole cell extract B. 66 ug whole cell extract of Dengue virus type 1 infected BHK-21 cells C. 20 ug whole cell extract of Dengue virus type 2 infected BHK-21 cells D. 10 ug whole cell extract of Dengue virus type 3 infected BHK-21 cells E. 66 ug whole cell extract of Dengue virus type 4 infected BHK-21 cells 10 % SDS-PAGE NS1 (Dengue virus) antibody dilution: 1:3000The results may vary from different DENV strains, viral infection status, and culture conditions.
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
CBL Antibody
NBP1-86588
Western Blot: CBL Antibody [NBP1-86588] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: CBL Antibody [NBP1-86588] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CBL Antibody [NBP1-86588] - Staining in human testis and skeletal muscle tissues using anti-CBL antibody. Corresponding CBL RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
IKK beta Antibody
(10AG2)
NB100-56509
Western Blot: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of A) human Daudi, B) HeLa, and C) mouse NIH3T3 lysate probed with IKKbeta antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: IKK beta Antibody (10AG2) [NB100-56509] - Formalin-fixed, paraffin-embedded human gall bladder probed with IKKbeta antibody at 5 ug/ml. Human tissue TMA was used for this test. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow Cytometry: IKK beta Antibody (10AG2) [NB100-56509] - Analysis of PE conjugate of NB100-56509. An intracellular stain was performed on Jurkat cells with IKK Beta antibody (10AG2) NB100-56509PE (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized wi
(1 Review)
(51 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
UEV2 Antibody
NB100-56360
Western Blot: UEV2 Antibody [NB100-56360] - Detection of UBE2V2 in HL-60 cell lysate with anti-UBE2V2 pcAb this antibody at 2ug/ml.
Species: Hu
Applications: WB
FNTA Antibody
NB100-56500
Western Blot: FNTA Antibody [NB100-56500] - analysis of FNTA in mouse colon cell lysate in the 1) absence and 2) presence of immunizing peptide using FNTA antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: FNTA Antibody [NB100-56500] - analysis of human prostate using FNTA antibody at 10 ug/ml.
Species: Hu, Rt, Ca, Ch, Pm
Applications: WB, IHC-P
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - KRAS monoclonal antibody (M01), clone 3B10-2F2 Analysis of KRAS expression in HeLa.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MYST3 Antibody
NBP2-57745
Immunocytochemistry/Immunofluorescence: MYST3 Antibody [NBP2-57745] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MYST3 Antibody [NBP2-57745] - Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GOLGA7 Antibody
(2H8)
H00051125-M01
GOLGA7 Antibody (2H8)
Species: Hu
Applications: WB, ELISA, IP

Publications for GOLGA7 Antibody (H00051125-M01)(1)


Reviews for GOLGA7 Antibody (H00051125-M01) (0)

There are no reviews for GOLGA7 Antibody (H00051125-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GOLGA7 Antibody (H00051125-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GOLGA7 Products

Bioinformatics Tool for GOLGA7 Antibody (H00051125-M01)

Discover related pathways, diseases and genes to GOLGA7 Antibody (H00051125-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLGA7 Antibody (H00051125-M01)

Discover more about diseases related to GOLGA7 Antibody (H00051125-M01).
 

Pathways for GOLGA7 Antibody (H00051125-M01)

View related products by pathway.

PTMs for GOLGA7 Antibody (H00051125-M01)

Learn more about PTMs related to GOLGA7 Antibody (H00051125-M01).

Blogs on GOLGA7

There are no specific blogs for GOLGA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLGA7 Antibody (2H8) and receive a gift card or discount.


Bioinformatics

Gene Symbol GOLGA7
Entrez
OMIM
Uniprot