We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GNPTG Recombinant Protein Antigen

Images

 
There are currently no images for GNPTG Protein (NBP1-88443PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GNPTG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNPTG.

Source: E. coli

Amino Acid Sequence: PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNPTG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88443.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNPTG Recombinant Protein Antigen

  • C16orf27
  • c316G12.3
  • CAB56184
  • GlcNAc-1-phosphotransferase subunit gamma
  • GNPTAGchromosome 16 open reading frame 27
  • LP2537
  • N-acetylglucosamine-1-phosphate transferase, gamma subunit
  • N-acetylglucosamine-1-phosphotransferase subunit gamma
  • N-acetylglucosamine-1-phosphotransferase, gamma subunit
  • RJD9
  • UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma

Background

GNPTG, also known as N-acetylglucosamine-1-phosphotransferase subunit gamma, is a 305 amino acid that is 34 kDa,; hexamer composed of two alpha, two beta and two gamma subunits, widely expressed; catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker, essential for targeting of lysosomal hydrolases to the lysosome. Studies are being performed on the relationship of this protein to mucolipidosis iii gamma, mucolipidosis, mucolipidosis iiic, mucolipidosis ii, dysostosis, short stature, autosomal recessive disease, scoliosis, parkinson's disease, ovarian carcinoma, and retinitis. GNPTG protein involvement has been observed with relation to UPF1 and GNPTAB proteins in the lysosome pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91347
Species: Hu
Applications: WB
NBP2-83254
Species: Hu
Applications: WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB5469
Species: Hu
Applications: ICC, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NBP1-86126
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DVC00
Species: Hu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-54873
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP2-49387
Species: Hu
Applications: IHC,  IHC-P
AF5647
Species: Hu, Mu
Applications: WB
NBP2-93766
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-88443PEP
Species: Hu
Applications: AC

Publications for GNPTG Protein (NBP1-88443PEP) (0)

There are no publications for GNPTG Protein (NBP1-88443PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNPTG Protein (NBP1-88443PEP) (0)

There are no reviews for GNPTG Protein (NBP1-88443PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GNPTG Protein (NBP1-88443PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNPTG Products

Blogs on GNPTG

There are no specific blogs for GNPTG, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GNPTG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPTG