GNL1 Antibody

Images

 
Independent Antibodies: Western Blot: GNL1 Antibody [NBP2-54938] - Analysis using Anti-GNL1 antibody NBP2-54938 (A) shows similar pattern to independent antibody NBP2-14062 (B).
Immunocytochemistry/ Immunofluorescence: GNL1 Antibody [NBP2-54938] - Staining of human cell line HEK 293 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

GNL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGE
Specificity
Specificity of human GNL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNL1 Recombinant Protein Antigen (NBP2-54938PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GNL1 Antibody

  • DKFZp547E038
  • DKFZp547E128
  • GTP-binding protein HSR1
  • guanine nucleotide binding protein-like 1
  • guanine nucleotide-binding protein-like 1
  • HSR1 GTP-binding protein
  • HSR1FLJ37752

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97475
Species: Hu, Mu, Rt, Ma, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP, ICC
NBP1-81649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-68281
Species: Hu, Mu, Rt, Pm
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3499
Species: Hu
Applications: WB
NBP2-16619
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-73623
Species: Hu
Applications: WB, ICC/IF, IHC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP2-54938
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for GNL1 Antibody (NBP2-54938) (0)

There are no publications for GNL1 Antibody (NBP2-54938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNL1 Antibody (NBP2-54938) (0)

There are no reviews for GNL1 Antibody (NBP2-54938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNL1 Antibody (NBP2-54938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GNL1 Products

Bioinformatics Tool for GNL1 Antibody (NBP2-54938)

Discover related pathways, diseases and genes to GNL1 Antibody (NBP2-54938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNL1 Antibody (NBP2-54938)

Discover more about diseases related to GNL1 Antibody (NBP2-54938).
 

Pathways for GNL1 Antibody (NBP2-54938)

View related products by pathway.

PTMs for GNL1 Antibody (NBP2-54938)

Learn more about PTMs related to GNL1 Antibody (NBP2-54938).

Blogs on GNL1

There are no specific blogs for GNL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNL1