GNIP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GNIP Antibody [NBP1-89751] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GNIP Antibody [NBP1-89751] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: GNIP Antibody [NBP1-89751] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: GNIP Antibody [NBP1-89751] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GNIP Antibody [NBP1-89751] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GNIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GNIP Antibody - BSA Free (NBP1-89751) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-GNIP Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GNIP Protein (NBP1-89751PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25851810).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GNIP Antibody - BSA Free

• Glycogenin-interacting protein
• GNIPRING finger protein 90
• RNF90tripartite motif protein TRIM7
• tripartite motif containing 7
• tripartite motif-containing 7
• tripartite motif-containing protein 7

Background

GNIP is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1, a B-box type 2, and a coiled-coil region. The protein localizes to both the nucleus and the cytoplasm, and may represent a participant in the initiation of glycogen synthesis. Multiple transcript variants have been found for this gene, and some of them encode the same isoform.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GNIP Antibody (NBP1-89751)(3)

Publications using NBP1-89751

• Zhou C, Zhang Z, Zhu X et al. N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1 EBioMedicine 2020-08-24 [PMID: 32853985] (ICC/IF, IF/IHC, Human)
• Hu X, Tang Z, Ma S et al. Tripartite motif-containing protein 7 regulates hepatocellular carcinoma cell proliferation via the DUSP6/p38 pathway Biochemical and Biophysical Research Communications 2019-03-01 [PMID: 30850165] (IHC-P, Human)
• Chakraborty A, Diefenbacher ME, Mylona A et al. The E3 ubiquitin ligase Trim7 mediates c-Jun/AP-1 activation by Ras signalling. Nat Commun 2015-04-08 [PMID: 25851810] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TRIM7