GNIP Antibody

Images

 
Western Blot: GNIP Antibody [NBP1-89751] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: GNIP Antibody [NBP1-89751] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: GNIP Antibody [NBP1-89751] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRVLKKELEDCEVFRSTEKKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREVAQKQNENLAQLGVEITQLSKLSSQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GNIP Protein (NBP1-89751PEP)
Publications
Read Publication using
NBP1-89751 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (83%). Human reactivity reported in scientific literature (PMID: 25851810).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNIP Antibody

  • Glycogenin-interacting protein
  • GNIPRING finger protein 90
  • RNF90tripartite motif protein TRIM7
  • tripartite motif containing 7
  • tripartite motif-containing 7
  • tripartite motif-containing protein 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NBP1-54755
Species: Hu
Applications: WB
NB100-185
Species: Hu
Applications: WB
AF5087
Species: Hu
Applications: WB, Simple Western, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-02864
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-46374
Species: Hu
Applications: WB, IHC
NBP1-81227
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GNIP Antibody (NBP1-89751)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GNIP Antibody (NBP1-89751) (0)

There are no reviews for GNIP Antibody (NBP1-89751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GNIP Antibody (NBP1-89751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNIP Products

Bioinformatics Tool for GNIP Antibody (NBP1-89751)

Discover related pathways, diseases and genes to GNIP Antibody (NBP1-89751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GNIP

There are no specific blogs for GNIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM7