GNGT1 Antibody (1F8)


Western Blot: GNGT1 Antibody (1F8) [H00002792-M01] - Analysis of GNGT1 expression in transfected 293T cell line by GNGT1 monoclonal antibody (M01), clone 1F8.Lane 1: GNGT1 transfected lysate(8.5 KDa).Lane 2: more
Sandwich ELISA: GNGT1 Antibody (1F8) [H00002792-M01] - Detection limit for recombinant GST tagged GNGT1 is 1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

GNGT1 Antibody (1F8) Summary

GNGT1 (AAH29367, 1 a.a. - 74 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
GNGT1 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (1F8)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNGT1 Antibody (1F8)

  • GNG1
  • guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1
  • guanine nucleotide-binding protein G(T) subunit gamma-T1
  • Transducin gamma chain


Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, IHC-Fr
Species: Hu
Species: Hu
Applications: WB, ELISA

Publications for GNGT1 Antibody (H00002792-M01) (0)

There are no publications for GNGT1 Antibody (H00002792-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNGT1 Antibody (H00002792-M01) (0)

There are no reviews for GNGT1 Antibody (H00002792-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNGT1 Antibody (H00002792-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GNGT1 Products

Bioinformatics Tool for GNGT1 Antibody (H00002792-M01)

Discover related pathways, diseases and genes to GNGT1 Antibody (H00002792-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNGT1 Antibody (H00002792-M01)

Discover more about diseases related to GNGT1 Antibody (H00002792-M01).

Pathways for GNGT1 Antibody (H00002792-M01)

View related products by pathway.

PTMs for GNGT1 Antibody (H00002792-M01)

Learn more about PTMs related to GNGT1 Antibody (H00002792-M01).

Research Areas for GNGT1 Antibody (H00002792-M01)

Find related products by research area.

Blogs on GNGT1

There are no specific blogs for GNGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GNGT1 Antibody (1F8) and receive a gift card or discount.


Gene Symbol GNGT1