GNGT1 Antibody (1F8) - Azide and BSA Free

Western Blot: GNGT1 Antibody (1F8) [H00002792-M01] - Analysis of GNGT1 expression in transfected 293T cell line by GNGT1 monoclonal antibody (M01), clone 1F8.Lane 1: GNGT1 transfected lysate(8.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: GNGT1 Antibody (1F8) [H00002792-M01] - Detection limit for recombinant GST tagged GNGT1 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GNGT1 Antibody (1F8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNGT1 (AAH29367, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS
• Specificity: GNGT1 - guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (1F8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNGT1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNGT1 Antibody (1F8) - Azide and BSA Free

• GNG1
• guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1
• guanine nucleotide-binding protein G(T) subunit gamma-T1
• Transducin gamma chain

Background

Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNGT1
• Entrez:
  • 2792(Human)
• Uniprot:
  • AAH29367(Human)