GNB1L Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human GNB1L. Peptide sequence: MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GNB1L |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for GNB1L Antibody - BSA Free
Background
The GNB1L gene codes a guanine nucleotide-binding protein subunit beta-like protein 1 that is a member of the WD repeat protein family. Isoform 1 is 327 amino acids long with a mass of around 35 kDA while isoform 2 exists at 212 amino acids long and nearly 23 kDA. Members of the WD repeat protein family are known for their involvement in many cellular responses such as: cycle progression, signal transduction, apoptosis, and gene regulation. The GNB1L gene can be found on chromosome 22q11, and if deleted, will cause DiGeorge syndrome. The GNB1L gene has been researched regarding its role in schizophrenia, spinal cord disease, carcinoma, cat eye syndrome, hypopharynx cancer, and visceral leishmaniasis. GNB1L gene interacts with genes KLHL12 and UBC in pathways such as the beta-agonist/beta blocker.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: Flow, ICC/IF, In vitro, In vivo
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for GNB1L Antibody (NBP2-84993) (0)
There are no publications for GNB1L Antibody (NBP2-84993).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GNB1L Antibody (NBP2-84993) (0)
There are no reviews for GNB1L Antibody (NBP2-84993).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GNB1L Antibody (NBP2-84993) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GNB1L Products
Research Areas for GNB1L Antibody (NBP2-84993)
Find related products by research area.
|
Blogs on GNB1L