Recombinant Human GNAT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GNAT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-354 of Human GNAT2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GNAT2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GNAT2 Protein

  • ACHM4guanine nucleotide-binding protein G(t) subunit alpha-2
  • cone-type transducin alpha subunit
  • GNATC
  • guanine nucleotide binding protein (G protein), alpha transducing activitypolypeptide 2
  • guanine nucleotide-binding protein G(t), alpha-2 subunit
  • Transducin alpha-2 chain
  • transducin, cone-specific, alpha polypeptide

Background

Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46273
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-58445
Species: Hu
Applications: IHC-P
NBP2-20696
Species: Hu, Mu
Applications: WB, IHC-Fr
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-98502
Species: Hu
Applications: WB
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-74460
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32617
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NLS1150
Species: Hu
Applications: IHC-P

Publications for GNAT2 Recombinant Protein (H00002780-P01) (0)

There are no publications for GNAT2 Recombinant Protein (H00002780-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNAT2 Recombinant Protein (H00002780-P01) (0)

There are no reviews for GNAT2 Recombinant Protein (H00002780-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNAT2 Recombinant Protein (H00002780-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNAT2 Products

GNAT2 H00002780-P01

Bioinformatics Tool for GNAT2 Recombinant Protein (H00002780-P01)

Discover related pathways, diseases and genes to GNAT2 Recombinant Protein (H00002780-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNAT2 Recombinant Protein (H00002780-P01)

Discover more about diseases related to GNAT2 Recombinant Protein (H00002780-P01).
 

Pathways for GNAT2 Recombinant Protein (H00002780-P01)

View related products by pathway.

Blogs on GNAT2

There are no specific blogs for GNAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAP2 Antibody
NB300-213

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GNAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAT2