GNAL Recombinant Protein Antigen

Images

 
There are currently no images for GNAL Recombinant Protein Antigen (NBP2-68695PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GNAL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNAL.

Source: E. coli

Amino Acid Sequence: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNAL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68695.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNAL Recombinant Protein Antigen

  • Adenylate cyclase-stimulating G alpha protein, olfactory type
  • guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ
  • guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type
  • guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type
  • guanine nucleotide-binding protein G(olf) subunit alpha

Background

Heterotrimeric G proteins function to relay information from cell surface receptors to intracellular effectors. Each of a very broad range of receptors specifically detects an extracellular stimulus (a photon, pheromone, odorant, hormone or neurotransmitter) while the effectors (e.g. adenyl cyclase), which act to generate one or more intracellular messengers, are less numerous. In mammals, G protein alpha, beta and gamma polypeptides are encoded by at least 16, 4 and 7 genes, respectively. Most interest in G proteins has been focused on their alpha subunits, since these proteins bind and hydrolyze GTP, and most obviously regulate the activity of the best studied effectors. The Gs subfamily of Galpha subunits includes two closely related proteins, Galpha s and Galpha olf, which, respectively, stimulate adenylate cyclase and mediate response to olfactory stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86352
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-03780
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-52477
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP3-45254
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP1-76864
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86985
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
MAB7555
Species: Hu
Applications: Simple Western, WB
AF3564
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NBP3-13181
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-68695PEP
Species: Hu
Applications: AC

Publications for GNAL Recombinant Protein Antigen (NBP2-68695PEP) (0)

There are no publications for GNAL Recombinant Protein Antigen (NBP2-68695PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNAL Recombinant Protein Antigen (NBP2-68695PEP) (0)

There are no reviews for GNAL Recombinant Protein Antigen (NBP2-68695PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GNAL Recombinant Protein Antigen (NBP2-68695PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNAL Products

Research Areas for GNAL Recombinant Protein Antigen (NBP2-68695PEP)

Find related products by research area.

Blogs on GNAL

There are no specific blogs for GNAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GNAL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAL