GNAL Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GNAL Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNAL.
  
  

  Source: E. coli

  Amino Acid Sequence: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GNAL
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68695.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNAL Recombinant Protein Antigen

• Adenylate cyclase-stimulating G alpha protein, olfactory type
• guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ
• guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type
• guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type
• guanine nucleotide-binding protein G(olf) subunit alpha

Background

Heterotrimeric G proteins function to relay information from cell surface receptors to intracellular effectors. Each of a very broad range of receptors specifically detects an extracellular stimulus (a photon, pheromone, odorant, hormone or neurotransmitter) while the effectors (e.g. adenyl cyclase), which act to generate one or more intracellular messengers, are less numerous. In mammals, G protein alpha, beta and gamma polypeptides are encoded by at least 16, 4 and 7 genes, respectively. Most interest in G proteins has been focused on their alpha subunits, since these proteins bind and hydrolyze GTP, and most obviously regulate the activity of the best studied effectors. The Gs subfamily of Galpha subunits includes two closely related proteins, Galpha s and Galpha olf, which, respectively, stimulate adenylate cyclase and mediate response to olfactory stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GNAL