Recombinant Human GMPPA Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GMPPA Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 321-420 of Human GMPPA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GMPPA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GMPPA Protein

  • EC 2.7.7
  • EC 2.7.7.13
  • GDP-mannose pyrophosphorylase Amannose-1-phosphate guanyltransferase alpha
  • GTP-mannose-1-phosphate guanylyltransferase alpha
  • mannose-1-phosphate guanylyltransferase (GDP)

Background

GMPPA - GDP-mannose pyrophosphorylase A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
H00064506-D01P
Species: Hu, Mu
Applications: WB, ELISA
AF7215
Species: Hu, Mu
Applications: IHC, ICC
H00029926-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GMPPA Partial Recombinant Protein (H00029926-Q01) (0)

There are no publications for GMPPA Partial Recombinant Protein (H00029926-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMPPA Partial Recombinant Protein (H00029926-Q01) (0)

There are no reviews for GMPPA Partial Recombinant Protein (H00029926-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMPPA Partial Recombinant Protein (H00029926-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GMPPA Products

Bioinformatics Tool for GMPPA Partial Recombinant Protein (H00029926-Q01)

Discover related pathways, diseases and genes to GMPPA Partial Recombinant Protein (H00029926-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for GMPPA Partial Recombinant Protein (H00029926-Q01)

View related products by pathway.

PTMs for GMPPA Partial Recombinant Protein (H00029926-Q01)

Learn more about PTMs related to GMPPA Partial Recombinant Protein (H00029926-Q01).
 

Research Areas for GMPPA Partial Recombinant Protein (H00029926-Q01)

Find related products by research area.

Blogs on GMPPA

There are no specific blogs for GMPPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GMPPA Antibody
NBP1-85904

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GMPPA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPPA