We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GM2A Recombinant Protein Antigen

Images

 
There are currently no images for GM2A Protein (NBP1-87090PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GM2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GM2A.

Source: E. coli

Amino Acid Sequence: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GM2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87090.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GM2A Recombinant Protein Antigen

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

GM2A, also known as Ganglioside GM2 activator, is a 193 amino acid that is 21 kDa, with lysosome subcellular location, acts as s a lipid transfer protein that stimulates the enzymatic processing of gangliosides and T-cell activation; acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A which, together with this activator, catalyzes the degradation of the ganglioside GM2; also displays some calcium-independent phospholipase activity. Disease research on this protein has shown a relationship with tay-sachs disease, gangliosidosis, gangliosidosis gm2, sandhoff disease, neurological disorder, candidiasis, protein s deficiency, neurodegenerative disease, tay-sachs disease ab variant, spinal muscular atrophy, lysosomal storage disease, muscular atrophy, sinusitis, gastric cancer, cholesterol, and neuronitis. The GM2A protein has also shown an interaction with PLD2, GPLD1 and HEXA in the Sphingolipid metabolism, glycosphingolipid metabolism, lysosome, and phospholipid metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8520
Species: Hu
Applications: ICC, IP, KO, Simple Western, WB
NBP2-93766
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-49211
Species: Hu
Applications: IHC,  IHC-P
AF6237
Species: Hu
Applications: Simple Western, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
1310-SE
Species: Hu
Applications: EnzAct
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
DUP00
Species: Hu
Applications: ELISA
MPTX20
Species: Mu
Applications: ELISA
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB100-56700
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88476
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-32799
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-16379
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87090PEP
Species: Hu
Applications: AC

Publications for GM2A Protein (NBP1-87090PEP) (0)

There are no publications for GM2A Protein (NBP1-87090PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Protein (NBP1-87090PEP) (0)

There are no reviews for GM2A Protein (NBP1-87090PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GM2A Protein (NBP1-87090PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GM2A Products

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GM2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GM2A