GM2A Antibody

Western Blot: GM2A Antibody [H00002760-B02P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

GM2A Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GM2A (NP_000396.2, 1 a.a. - 193 a.a.) full-length human protein. MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GM2A
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM2A Antibody

• Cerebroside sulfate activator protein
• ganglioside GM2 activator
• GM2 ganglioside activator
• GM2-AP
• SAP-3GM2 ganglioside activator protein
• Shingolipid activator protein 3
• sphingolipid activator protein 3

Background

GM2A, also known as Ganglioside GM2 activator, is a 193 amino acid that is 21 kDa, with lysosome subcellular location, acts as s a lipid transfer protein that stimulates the enzymatic processing of gangliosides and T-cell activation; acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A which, together with this activator, catalyzes the degradation of the ganglioside GM2; also displays some calcium-independent phospholipase activity. Disease research on this protein has shown a relationship with tay-sachs disease, gangliosidosis, gangliosidosis gm2, sandhoff disease, neurological disorder, candidiasis, protein s deficiency, neurodegenerative disease, tay-sachs disease ab variant, spinal muscular atrophy, lysosomal storage disease, muscular atrophy, sinusitis, gastric cancer, cholesterol, and neuronitis. The GM2A protein has also shown an interaction with PLD2, GPLD1 and HEXA in the Sphingolipid metabolism, glycosphingolipid metabolism, lysosome, and phospholipid metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GM2A
• Uniprot:
  • NP_000396.2(Human)