Home » GM2A » GM2A Antibodies » GM2A Antibody

GM2A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GM2A Antibody [H00002760-B01P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.
Western Blot: GM2A Antibody [H00002760-B01P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GM2A Antibody Summary

Immunogen
GM2A (AAH09273, 1 a.a. - 193 a.a.) full-length human protein. MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFERFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Specificity
GM2A - GM2 ganglioside activator,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GM2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM2A Antibody

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PSAP Antibody
NBP1-83363
Western Blot: PSAP Antibody [NBP1-83363] - Analysis in human cell lines SK-MEL-30 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/Immunofluorescence: PSAP Antibody [NBP1-83363] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSAP Antibody [NBP1-83363] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PSAP antibody. Corresponding PSAP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MTCH1 Knockout
HeLa Cell Lysate
NBP2-65033
MTCH1 Knockout HeLa Cell Lysate
Species: Hu
HEXB [Unconjugated]
8907-GH
HEXB [Unconjugated]
Species: Hu
Hexosaminidase
A/HEXA Antibody (7147
MAB6237
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and human liver tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Hexosaminidase A/HEXA Monoclonal Antibody (Catalog # MAB6237) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Hexosaminidase A/HEXA at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Hexosaminidase A/HEXA was detected in immersion fixed paraffin-embedded sections of human brain (hypothalamus) using Mouse Anti-Human Hexosaminidase A/HEXA Monoclonal Antibody (Catalog # MAB6237) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm and lysosomes in neuronal cell bodies. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Arylsulfatase
A/ARSA Antibody
NBP1-86135
Western Blot: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Analysis in human cell line Jurkat.
Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Staining in human testis and skeletal muscle tissues using anti-ARSA antibody. Corresponding ARSA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
u-Plasminogen
Activator/Urokinase A ...
AF1310
u-Plasminogen Activator (uPA)/Urokinase was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Goat Anti-Human u-Plasminogen Activator (uPA)/Urokinase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1310) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of immersion fixed paraffin-embedded Tissue Sections.
u-Plasminogen Activator (uPA)/Urokinase was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Goat Anti-Human u-Plasminogen Activator (uPA)/Urokinase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1310) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Publications)
Species: Hu
Applications: WB, IHC, IP
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - SH2D1A monoclonal antibody (M01), clone 1C9 Analysis of SH2D1A expression in Jurkat.
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.Lane 1: SH2D1A transfected lysate(14.2 KDa).Lane 2: Non-transfected lysate.
ELISA: SH2D1A Antibody (1C9) [H00004068-M01] - Detection limit for recombinant GST tagged SH2D1A is 0.3 ng/ml as a capture antibody.
(6 Publications)
Species: Hu
Applications: WB, ELISA

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western blot shows lysates of mouse kidney tissue, mouse liver tissue, and human kidney tissue. PVDF membrane was probed with 0.2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Pentraxin 2/SAP at approximately 26 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Pentraxin 2/SAP at approximately 36 kDa (as indicated) using 2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu, Rt
Applications: WB, IHC
MD-1/LY86 Antibody
NB100-56700
Western Blot: MD-1/LY86 Antibody [NB100-56700] - Analysis of MD-1 in Ramos lysate using MD-1 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: MD-1/LY86 Antibody [NB100-56700] - Analysis of human spleen using MD-1 antibody at 10 ug/ml.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
PCNA associated
factor Antibody (3C11 ...
H00009768-M01
Western Blot: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Western Blot analysis of KIAA0101 expression in JAR ( Cat # L003V1 ).
Immunocytochemistry/Immunofluorescence: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PCNA associated factor Antibody (3C11-1F11) [H00009768-M01] - Analysis of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. Antibody concentration 3 ug/ml.
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
C1GALT1 Antibody
(1F1)
H00056913-M01
Western Blot: C1GALT1 Antibody (1F1) [H00056913-M01] - C1GALT1 monoclonal antibody (M01), clone 1F1 Analysis of C1GALT1 expression in HeLa.
Immunohistochemistry-Paraffin: C1GALT1 Antibody (1F1) [H00056913-M01] - Analysis of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.
ELISA: C1GALT1 Antibody (1F1) [H00056913-M01] - Detection limit for recombinant GST tagged C1GALT1 is approximately 0.3ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Paxillin Antibody
(SY23-02)
NBP2-67427
Western Blot: Paxillin Antibody (SY23-02) [NBP2-67427] - Analysis of Paxillin on NIH/3T3 cells lysates using anti-Paxillin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Paxillin Antibody (SY23-02) [NBP2-67427] - Staining Paxillin in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Paxillin Antibody (SY23-02) [NBP2-67427] - Analysis of paraffin-embedded mouse testis tissue using anti-Paxillin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Glycogen
Phosphorylase BB/GPBB
NBP1-32799
Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - Sample(30 ug whole cell lysate)A:Hep G2 7. 5% SDS PAGE, antibody diluted at 1:2000.
Immunohistochemistry-Paraffin: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - at cytosol on mouse fore brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse fore brain. Dilution: 1:500.
Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - Sample (50 ug of whole cell lysate) A: Mouse brain 7. 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
HMGA1 Antibody
NB100-56468
Western Blot: HMGA1 Antibody [NB100-56468] - Analysis of HMGA1 in the 1) absence and 2) presence of immunizing peptide in human pancreas lysate using this antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: HMGA1 Antibody [NB100-56468] - Staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
GM2A Antibody
H00002760-B01P
GM2A Antibody
Species: Hu
Applications: WB

Publications for GM2A Antibody (H00002760-B01P) (0)

There are no publications for GM2A Antibody (H00002760-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Antibody (H00002760-B01P) (0)

There are no reviews for GM2A Antibody (H00002760-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM2A Antibody (H00002760-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM2A Products

Bioinformatics Tool for GM2A Antibody (H00002760-B01P)

Discover related pathways, diseases and genes to GM2A Antibody (H00002760-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM2A Antibody (H00002760-B01P)

Discover more about diseases related to GM2A Antibody (H00002760-B01P).
 

Pathways for GM2A Antibody (H00002760-B01P)

View related products by pathway.

PTMs for GM2A Antibody (H00002760-B01P)

Learn more about PTMs related to GM2A Antibody (H00002760-B01P).

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM2A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GM2A
Entrez
Uniprot