Home » GM2A » GM2A Antibodies » GM2A Antibody

GM2A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GM2A Antibody [H00002760-B01P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.
Western Blot: GM2A Antibody [H00002760-B01P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related GM2A Primary Antibodies

Order Details


    • Catalog Number
      H00002760-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GM2A Antibody Summary

Immunogen
GM2A (AAH09273, 1 a.a. - 193 a.a.) full-length human protein. MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFERFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Specificity
GM2A - GM2 ganglioside activator,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GM2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM2A Antibody

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PSAP Antibody
[Unconjugated]
AF8520
Western blot shows lysates of A431 human epithelial carcinoma cell line. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human PSAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8520) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for PSAP at approximately 60-80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PSAP was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human PSAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8520) at 1:100 dilution for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to Golgi. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ICC
MTCH1 Antibody
NBP1-69285
Western Blot: MTCH1 Antibody [NBP1-69285] - This Anti-MTCH1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Species: Hu
Applications: WB
HEXB Antibody
NBP2-49211
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human prostate shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human epididymis shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human colon, epididymis, kidney and liver using Anti-HEXB antibody NBP2-49211 (A) shows similar protein distribution across tissues to independent antibody NBP2-48689 (B).
Species: Hu
Applications: IHC, IHC-P
Hexosaminidase
A/HEXA Antibody [Unco ...
AF6237
Western blot shows lysate of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human Hexosaminidase A/HEXA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6237) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Hexosaminidase A/HEXA at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysate of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Hexosaminidase A/HEXA at approximately 59 kDa (as indicated) using 20 µg/mL of Sheep Anti-Human Hexosaminidase A/HEXA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6237) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Hu
Applications: WB, Simple Western
Arylsulfatase
A/ARSA Antibody
NBP1-86135
Western Blot: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Analysis in human cell line Jurkat.
Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Arylsulfatase A/ARSA Antibody [NBP1-86135] - Analysis in human testis and skeletal muscle tissues. Corresponding ARSA RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Recombinant Human u-Plasminogen Activator/Urokinase (Catalog # 1310-SE) is measured by its ability to cleave a peptide substrate,N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC).
(8 Publications)
Species: Hu
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.Lane 1: SH2D1A transfected lysate(14.2 KDa).Lane 2: Non-transfected lysate.
Flow Cytometry: SH2D1A Antibody (1C9) [H00004068-M01] - Intracellular staining of human T cells with SH2D1A monoclonal antibody or isotype control antibody, followed by a Polyclonal Goat Anti-Mouse/RPE secondary antibody. Grey filled histogram: Isotype control, empty blue histogram: SH2D1A antibody. Flow cytometry image submitted by a verified customer review.
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - SH2D1A monoclonal antibody (M01), clone 1C9 Analysis of SH2D1A expression in Jurkat.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
(5 Publications)
Species: All-NA
Applications: WB, IHC, IHC-P
uPAR [HRP]
DUP00
(34 Publications)
Species: Hu
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western blot shows lysates of mouse kidney tissue, mouse liver tissue, and human kidney tissue. PVDF membrane was probed with 0.2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Pentraxin 2/SAP at approximately 26 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Pentraxin 2/SAP at approximately 36 kDa (as indicated) using 2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
MD-1/LY86 Antibody
NB100-56700
Western Blot: MD-1/LY86 Antibody [NB100-56700] - Analysis of MD-1 in Ramos lysate using MD-1 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: MD-1/LY86 Antibody [NB100-56700] - Analysis of human spleen using MD-1 antibody at 10 ug/ml.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
C1GALT1 Antibody
NBP1-88476
Immunocytochemistry/Immunofluorescence: C1GALT1 Antibody [NBP1-88476] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88476] - Staining of human cerebral cortex shows strong positivity in neuropil.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Paxillin [p
Tyr118] Antibody
NBP2-24459
Western Blot: Paxillin [p Tyr118] Antibody [NBP2-24459] - Analysis of phospho Paxillin (Y118) in recombinant fusion protein containing 1) a phosphorylated tyrosine at position 118 and 2) an unphosphorylated tyrosine at position 118, using paxillin phospho antibody at 0.025 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(2 Publications)
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
Glycogen
Phosphorylase BB/GPBB
NBP1-32799
Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GPBB antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - at cytosol on mouse fore brain by immunohistochemical analysis. Sample: Paraffin-embedded mouse fore brain. Dilution: 1:500.
Western Blot: Glycogen Phosphorylase BB/GPBB Antibody [NBP1-32799] - Sample (50 ug of whole cell lysate) A: Mouse brain 7. 5% SDS PAGE; antibody diluted at 1:1000.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
HMGA1B Antibody
AF5956
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line, 293T human embryonic kidney cell line, HeLa human cervical epithelial carcinoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse HMGA1B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5956) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for HMGA1B at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group  1.
(1 Review)
Species: Hu, Mu
Applications: WB
GM2A Antibody
H00002760-B01P
GM2A Antibody
Species: Hu
Applications: WB

Publications for GM2A Antibody (H00002760-B01P) (0)

There are no publications for GM2A Antibody (H00002760-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Antibody (H00002760-B01P) (0)

There are no reviews for GM2A Antibody (H00002760-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM2A Antibody (H00002760-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GM2A Products

Bioinformatics Tool for GM2A Antibody (H00002760-B01P)

Discover related pathways, diseases and genes to GM2A Antibody (H00002760-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM2A Antibody (H00002760-B01P)

Discover more about diseases related to GM2A Antibody (H00002760-B01P).
 

Pathways for GM2A Antibody (H00002760-B01P)

View related products by pathway.

PTMs for GM2A Antibody (H00002760-B01P)

Learn more about PTMs related to GM2A Antibody (H00002760-B01P).

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM2A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GM2A
Entrez
Uniprot