GM2A Antibody Summary
Immunogen |
GM2A (AAH09273, 1 a.a. - 193 a.a.) full-length human protein. MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFERFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
Specificity |
GM2A - GM2 ganglioside activator, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
GM2A |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GM2A Antibody
Background
This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
Species: All-NA
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Publications for GM2A Antibody (H00002760-B01P) (0)
There are no publications for GM2A Antibody (H00002760-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GM2A Antibody (H00002760-B01P) (0)
There are no reviews for GM2A Antibody (H00002760-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GM2A Antibody (H00002760-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional GM2A Products
Bioinformatics Tool for GM2A Antibody (H00002760-B01P)
Discover related pathways, diseases and genes to GM2A Antibody (H00002760-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GM2A Antibody (H00002760-B01P)
Discover more about diseases related to GM2A Antibody (H00002760-B01P).
| | Pathways for GM2A Antibody (H00002760-B01P)
View related products by pathway.
|
PTMs for GM2A Antibody (H00002760-B01P)
Learn more about PTMs related to GM2A Antibody (H00002760-B01P).
|
Blogs on GM2A