GM2A Antibody

Images

 
Western Blot: GM2A Antibody [H00002760-B01P] - Analysis of GM2A expression in transfected 293T cell line by GM2A polyclonal antibody. Lane 1: GM2A transfected lysate(21.34 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GM2A Antibody Summary

Immunogen
GM2A (AAH09273, 1 a.a. - 193 a.a.) full-length human protein. MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFERFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Specificity
GM2A - GM2 ganglioside activator,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GM2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM2A Antibody

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
8907-GH
Species: Hu
MAB6237
Species: Hu
Applications: WB, IHC
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56700
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-47446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
H00002760-B01P
Species: Hu
Applications: WB

Publications for GM2A Antibody (H00002760-B01P) (0)

There are no publications for GM2A Antibody (H00002760-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Antibody (H00002760-B01P) (0)

There are no reviews for GM2A Antibody (H00002760-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM2A Antibody (H00002760-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM2A Products

Bioinformatics Tool for GM2A Antibody (H00002760-B01P)

Discover related pathways, diseases and genes to GM2A Antibody (H00002760-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM2A Antibody (H00002760-B01P)

Discover more about diseases related to GM2A Antibody (H00002760-B01P).
 

Pathways for GM2A Antibody (H00002760-B01P)

View related products by pathway.

PTMs for GM2A Antibody (H00002760-B01P)

Learn more about PTMs related to GM2A Antibody (H00002760-B01P).

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GM2A
Entrez
Uniprot